DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ITK and dock

DIOPT Version :10

Sequence 1:NP_005537.3 Gene:ITK / 3702 HGNCID:6171 Length:620 Species:Homo sapiens
Sequence 2:NP_722657.1 Gene:dock / 33262 FlyBaseID:FBgn0010583 Length:548 Species:Drosophila melanogaster


Alignment Length:78 Identity:33/78 - (42%)
Similarity:46/78 - (58%) Gaps:4/78 - (5%)


- Green bases have known domain annotations that are detailed below.


Human   176 VIALYDYQTNDPQELALRRNEEYCLLDSSEIHWWRVQDRNGHEGYVPSSYLVEKSPNNLETYEWY 240
            |:|.|||.....|||.||:||.|.|||.|: ||||||:.....|||||:|:.::.|:   .::..
  Fly   155 VVAKYDYAAQGAQELDLRKNERYLLLDDSK-HWWRVQNSRNQSGYVPSNYVKKEKPS---LFDSI 215

Human   241 NKSISRDKAEKLL 253
            .|.:.:....|.|
  Fly   216 KKKVKKGSGSKTL 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ITKNP_005537.3 PH_Btk 7..148 CDD:269944
SH3_ITK 174..229 CDD:212841 29/52 (56%)
SH2_Tec_Itk 232..340 CDD:198259 3/22 (14%)
PTKc_Itk 358..613 CDD:133243
dockNP_722657.1 SH3_Nck_1 154..204 CDD:212699 28/49 (57%)
SH3_Nck_2 256..308 CDD:212700
SH3_Nck_3 328..383 CDD:212701
SH2_Nck_family 446..538 CDD:198196
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.