DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34195 and ALKBH8

DIOPT Version :9

Sequence 1:NP_001097360.1 Gene:CG34195 / 37018 FlyBaseID:FBgn0085224 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_001287939.2 Gene:ALKBH8 / 91801 HGNCID:25189 Length:664 Species:Homo sapiens


Alignment Length:314 Identity:67/314 - (21%)
Similarity:103/314 - (32%) Gaps:102/314 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 EPLEPDVITTQAKELSAVERQKLDEQNKRGLVPEYKANK-----------LEIDAQRNWDIFYKR 55
            |.|:..:||:...:|:.         :||||...:...|           |..|:||      |.
Human   306 ESLKSGIITSDVGDLTL---------SKRGLRTSFTFRKVRQTPCNCSYPLVCDSQR------KE 355

  Fly    56 NETRFFKDRHWTTREFQELLDQ--EEF--HEKRT--------------------LFEVGCGVGNL 96
            ....|.:.....:|..||.:.|  ||.  |...|                    :.::|||.|..
Human   356 TPPSFPESDKEASRLEQEYVHQVYEEIAGHFSSTRHTPWPHIVEFLKALPSGSIVADIGCGNGKY 420

  Fly    97 VFPLLEEQTSEEGCFSNSRFFFYACDFSPRAVEFVRSNPLYDPSQISAFQCDITTQQVHDHIPPS 161
            :           |.  |...:...||.|...|:..|..      |..||.||.....|..    .
Human   421 L-----------GI--NKELYMIGCDRSQNLVDICRER------QFQAFVCDALAVPVRS----G 462

  Fly   162 SVDICTLIFVLSAIH----PQKFKDVVQNLGKLLKPGGLLLFRDYGL---YDMAQLRFKPGNKIA 219
            |.|.|..|.|   ||    .::....:|.:.:||:|||..|...:.:   |:..:.::..||:  
Human   463 SCDACISIAV---IHHFATAERRVAALQEIVRLLRPGGKALIYVWAMEQEYNKQKSKYLRGNR-- 522

  Fly   220 ENLYVRQDGTRSYFFSEEEVSKLFQENGFEVITNAYVHRRTLNLKEGV-DVPRI 272
                 ...|.:....|:..|.:...|           ..|.:..::.. .||||
Human   523 -----NSQGKKEEMNSDTSVQRSLVE-----------QMRDMGSRDSASSVPRI 560

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34195NP_001097360.1 Methyltransf_12 88..>175 CDD:369778 22/86 (26%)
ALKBH8NP_001287939.2 DUF1891 1..37 CDD:117570
RRM_ALKBH8 42..122 CDD:409865
2OG-FeII_Oxy 152..334 CDD:419693 9/36 (25%)
Alpha-ketoglutarate binding. /evidence=ECO:0000269|PubMed:22065580 227..229
Methyltransf_25 410..497 CDD:404528 28/112 (25%)
Methyltransferase domain 411..664 43/194 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 515..575 11/64 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.