DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34195 and METTL8

DIOPT Version :9

Sequence 1:NP_001097360.1 Gene:CG34195 / 37018 FlyBaseID:FBgn0085224 Length:283 Species:Drosophila melanogaster
Sequence 2:XP_016860473.1 Gene:METTL8 / 79828 HGNCID:25856 Length:468 Species:Homo sapiens


Alignment Length:380 Identity:121/380 - (31%)
Similarity:173/380 - (45%) Gaps:110/380 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 PLEPDVITTQA--------------KELSAVERQKLDEQNKRGLVPEYKANKLEIDAQRNWDIFY 53
            ||...::|..|              ||..|..|:|:.|.:...::.|.:. |.|.:|.:.||.||
Human    78 PLGSRILTDPAKVFEHNMWDHMQWSKEEEAAARKKVKENSAVRVLLEEQV-KYEREASKYWDTFY 141

  Fly    54 KRNETRFFKDRHWTTREFQELL-----------------------------------DQEEFHEK 83
            |.::.:|||||:|..|||.|:|                                   |::..:||
Human   142 KIHKNKFFKDRNWLLREFPEILPVDQKPEEKARESSWDHVKTSATNRFSRMHCPTVPDEKNHYEK 206

  Fly    84 RT---------------------------------------LFEVGCGVGNLVFPLLEE-QTSEE 108
            .:                                       :.|||||.||.|||:|.. :.|.|
Human   207 SSGSSEGQSKTESDFSNLDSEKHKKGPMETGLFPGSNATFRILEVGCGAGNSVFPILNTLENSPE 271

  Fly   109 GCFSNSRFFFYACDFSPRAVEFV-------------RSNPLYDPSQISAFQCDITTQQVHDHIPP 160
            .       |.|.|||:..|||.|             :|:..|..:|..||..|:....:....|.
Human   272 S-------FLYCCDFASGAVELVKVCYSWESYQLMPKSHSSYRATQCFAFVHDVCDDGLPYPFPD 329

  Fly   161 SSVDICTLIFVLSAIHPQKFKDVVQNLGKLLKPGGLLLFRDYGLYDMAQLRFKPGNKIAENLYVR 225
            ..:|:..|:||||:|||.:.:.||..|.|||||||:|||||||.||..|||||.|:.::||.|||
Human   330 GILDVILLVFVLSSIHPDRMQGVVNRLSKLLKPGGMLLFRDYGRYDKTQLRFKKGHCLSENFYVR 394

  Fly   226 QDGTRSYFFSEEEVSKLFQENGFEVITNAYVHRRTLNLKEGVDVPRIFLQGKFRR 280
            .||||:|||::.||..:|.:...:...|....|..:|.|:.|.:.|:::||||::
Human   395 GDGTRAYFFTKGEVHSMFCKASLDEKQNLVDRRLQVNRKKQVKMHRVWIQGKFQK 449

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34195NP_001097360.1 Methyltransf_12 88..>175 CDD:369778 35/100 (35%)
METTL8XP_016860473.1 Methyltransf_25 248..364 CDD:379312 46/122 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2361
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D378076at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.