DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34195 and Mettl6

DIOPT Version :9

Sequence 1:NP_001097360.1 Gene:CG34195 / 37018 FlyBaseID:FBgn0085224 Length:283 Species:Drosophila melanogaster
Sequence 2:XP_036014717.1 Gene:Mettl6 / 67011 MGIID:1914261 Length:332 Species:Mus musculus


Alignment Length:270 Identity:152/270 - (56%)
Similarity:195/270 - (72%) Gaps:12/270 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 QAKELSAVERQKLDEQNKRGLVPEYKANKLEIDAQRNWDIFYKRNETRFFKDRHWTTREFQELLD 76
            ||:.||..|.:||  :..:.||..:|..|||.:||:|||:|||||.|.||||||||||||:||..
Mouse    60 QARILSTEEEEKL--KRDQALVSAFKQQKLEKEAQKNWDLFYKRNSTNFFKDRHWTTREFEELRS 122

  Fly    77 QEEFH-EKRTLFEVGCGVGNLVFPLLEEQTSEEGCFSNSRFFFYACDFSPRAVEFVRSNPLYDPS 140
            ..|:. :|.||.|.||||||.:||||||..:         .|.||||||||||::|:.:|||:..
Mouse   123 CREYEGQKLTLLEAGCGVGNCLFPLLEEDLN---------LFAYACDFSPRAVDYVKQHPLYNAE 178

  Fly   141 QISAFQCDITTQQVHDHIPPSSVDICTLIFVLSAIHPQKFKDVVQNLGKLLKPGGLLLFRDYGLY 205
            :...||||:|...:.||:||.|||..||||||||:||:|.:.|:.|:.|:||||..:|||||||.
Mouse   179 RCKVFQCDLTRDDLLDHVPPESVDAVTLIFVLSAVHPEKMRLVLLNVYKVLKPGRSVLFRDYGLN 243

  Fly   206 DMAQLRFKPGNKIAENLYVRQDGTRSYFFSEEEVSKLFQENGFEVITNAYVHRRTLNLKEGVDVP 270
            |.|.||||.|:|:.||.||||||||||||::|.:::||.:.|:|.:.|.||.|.|:|.|||:.||
Mouse   244 DHAMLRFKAGSKLGENFYVRQDGTRSYFFTDEFLAQLFVDAGYEEVVNEYVFRETVNKKEGLCVP 308

  Fly   271 RIFLQGKFRR 280
            |:|||.|||:
Mouse   309 RVFLQSKFRK 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34195NP_001097360.1 Methyltransf_12 88..>175 CDD:369778 47/86 (55%)
Mettl6XP_036014717.1 Methyltransf_12 134..232 CDD:400515 56/106 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167850550
Domainoid 1 1.000 124 1.000 Domainoid score I5527
eggNOG 1 0.900 - - E1_KOG2361
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H12069
Inparanoid 1 1.050 309 1.000 Inparanoid score I2586
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG51971
OrthoDB 1 1.010 - - D378076at33208
OrthoFinder 1 1.000 - - FOG0000942
OrthoInspector 1 1.000 - - oto92978
orthoMCL 1 0.900 - - OOG6_104549
Panther 1 1.100 - - LDO PTHR22809
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1971
SonicParanoid 1 1.000 - - X3769
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1615.800

Return to query results.
Submit another query.