DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34195 and METTL2B

DIOPT Version :9

Sequence 1:NP_001097360.1 Gene:CG34195 / 37018 FlyBaseID:FBgn0085224 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_060866.2 Gene:METTL2B / 55798 HGNCID:18272 Length:378 Species:Homo sapiens


Alignment Length:335 Identity:120/335 - (35%)
Similarity:167/335 - (49%) Gaps:77/335 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 AKELSAVERQKLDEQNKRGLVPEYKANKLEIDAQRNWDIFYKRNETRFFKDRHWTTREFQEL--- 74
            ::|.:|...:|:.|.:.:.:..| |....||:|.:.|:.|||.:|..|||||||...||.||   
Human    43 SEEQAAAAERKVQENSIQRVCQE-KQVDYEINAHKYWNDFYKIHENGFFKDRHWLFTEFPELAPS 106

  Fly    75 ----------------------------LDQEEFH-------EKRT------------------- 85
                                        |..||.|       |.:|                   
Human   107 QNQNHLKDWFLENKSEVCECRNNEDGPGLIMEEQHKCSSKSLEHKTQTPPVEENVTQKISDLEIC 171

  Fly    86 ------------LFEVGCGVGNLVFPLLEEQTSEEGCFSNSRFFFYACDFSPRAVEFVRSNPLYD 138
                        :.||||||||.|||:|  ||:     ::...|.|.||||..|:|.|::|..||
Human   172 ADEFPGSSATYRILEVGCGVGNTVFPIL--QTN-----NDPGLFVYCCDFSSTAIELVQTNSEYD 229

  Fly   139 PSQISAFQCDITTQQVHDHIPPSSVDICTLIFVLSAIHPQKFKDVVQNLGKLLKPGGLLLFRDYG 203
            ||:..||..|:..::....:|..|:||..|||||||:.|.|.:..:..|.:||||||::|.||||
Human   230 PSRCFAFVHDLCDEEKSYPVPKGSLDIIILIFVLSAVVPDKMQKAINRLSRLLKPGGMVLLRDYG 294

  Fly   204 LYDMAQLRFKPGNKIAENLYVRQDGTRSYFFSEEEVSKLFQENGFEVITNAYVHRRTLNLKEGVD 268
            .|||||||||.|..::.|.|||.||||.|||::||:..||...|.|.:.|....|..:|..:.:.
Human   295 RYDMAQLRFKKGQCLSGNFYVRGDGTRVYFFTQEELDTLFTTAGLEKVQNLVDRRLQVNRGKQLT 359

  Fly   269 VPRIFLQGKF 278
            :.|:::|.|:
Human   360 MYRVWIQCKY 369

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34195NP_001097360.1 Methyltransf_12 88..>175 CDD:369778 41/86 (48%)
METTL2BNP_060866.2 Methyltransf_25 184..286 CDD:379312 49/108 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 163 1.000 Domainoid score I3968
eggNOG 1 0.900 - - E1_KOG2361
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D378076at33208
OrthoFinder 1 1.000 - - FOG0000942
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.