DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34195 and Mettl2

DIOPT Version :9

Sequence 1:NP_001097360.1 Gene:CG34195 / 37018 FlyBaseID:FBgn0085224 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_766155.3 Gene:Mettl2 / 52686 MGIID:1289171 Length:389 Species:Mus musculus


Alignment Length:330 Identity:116/330 - (35%)
Similarity:163/330 - (49%) Gaps:70/330 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 AKELSAVERQKLDEQNKRGLVPEYKANKLEIDAQRNWDIFYKRNETRFFKDRHWTTREFQEL--- 74
            ::|.:|...:|:.|.:...:.|| |....|::|.:.||.||:.:|..|||||||...||.||   
Mouse    43 SEEQAAAAERKVQENSSPLVCPE-KQVDYEVNAHKYWDDFYRIHENGFFKDRHWLFTEFPELAPS 106

  Fly    75 --------------------------------------------------------LDQEEFHEK 83
                                                                    :..|||...
Mouse   107 HSHLTGVPLEKQRSDVCEDGPGLTAEQHKCSCASPGCETQVPPLEEPVTQKLGHLEISGEEFPGS 171

  Fly    84 RT---LFEVGCGVGNLVFPLLEEQTSEEGCFSNSRFFFYACDFSPRAVEFVRSNPLYDPSQISAF 145
            ..   :.||||||||.|||:|  ||:     :|...|.|.||||..|:|.:::|..||||:..||
Mouse   172 SATYRILEVGCGVGNTVFPIL--QTN-----NNPNLFVYCCDFSATAIELLKTNSQYDPSRCYAF 229

  Fly   146 QCDITTQQVHDHIPPSSVDICTLIFVLSAIHPQKFKDVVQNLGKLLKPGGLLLFRDYGLYDMAQL 210
            ..|:..:.....:|..|:|:..||||||||.|.|.:..:..|.:||||||::|.||||.||||||
Mouse   230 VHDLCDEDQSYPVPEDSLDVIVLIFVLSAIVPDKMQKAISKLSRLLKPGGVMLLRDYGRYDMAQL 294

  Fly   211 RFKPGNKIAENLYVRQDGTRSYFFSEEEVSKLFQENGFEVITNAYVHRRTLNLKEGVDVPRIFLQ 275
            |||.|..::.|.|||.||||.|||::.|:..||...|.|.:.|....|..:|..:.:.:.|:::|
Mouse   295 RFKKGQCLSGNFYVRGDGTRVYFFTQGELDTLFTAAGLEKVQNLVDRRLQVNRGKQLTMYRVWIQ 359

  Fly   276 GKFRR 280
            .|:.:
Mouse   360 CKYSK 364

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34195NP_001097360.1 Methyltransf_12 88..>175 CDD:369778 40/86 (47%)
Mettl2NP_766155.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..20
Methyltransf_12 178..280 CDD:369778 50/108 (46%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2361
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D378076at33208
OrthoFinder 1 1.000 - - FOG0000942
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.