DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34195 and Mettl8

DIOPT Version :9

Sequence 1:NP_001097360.1 Gene:CG34195 / 37018 FlyBaseID:FBgn0085224 Length:283 Species:Drosophila melanogaster
Sequence 2:XP_008760176.1 Gene:Mettl8 / 502633 RGDID:1561059 Length:408 Species:Rattus norvegicus


Alignment Length:332 Identity:116/332 - (34%)
Similarity:169/332 - (50%) Gaps:71/332 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 AKELSAVERQKLDEQNKRGLVPEYKANKLEIDAQRNWDIFYKRNETRFFKDRHWTTREFQELL-- 75
            :||.....|:|::|.:...:.||.:. |.|..|.:.||.||:.::.:|||:|:|..|||.|:|  
  Rat    66 SKEEEDEARKKVEENSATRVAPEEQV-KFENAANKYWDTFYQTHKNKFFKNRNWLLREFPEILPV 129

  Fly    76 DQE-----------------------EFHEKRT-------------------------------- 85
            ||.                       |.|.:.|                                
  Rat   130 DQNTKEKLGESSWDPARSSISRTQGTETHRQETFVSSEPGSRERSASNPDLEEYSRGPRKAEQFP 194

  Fly    86 -------LFEVGCGVGNLVFPLLEEQTSEEGCFSNSRFFFYACDFSPRAVEFVRSNPLYDPSQIS 143
                   :.|||||.||.|||:|....:..|.      |.|.|||:|.|||.|:|:..|..:..|
  Rat   195 GSKATFRILEVGCGAGNSVFPILNTLQNIPGS------FLYCCDFAPEAVELVKSHEAYSEAHCS 253

  Fly   144 AFQCDITTQQVHDHIPPSSVDICTLIFVLSAIHPQKFKDVVQNLGKLLKPGGLLLFRDYGLYDMA 208
            ||..|:....:....|..::|:..|:||||:|||.:.:.|:..|.:||||||:|||||:|.||.|
  Rat   254 AFIHDVCDDGLAYPFPDGTLDVILLVFVLSSIHPDRMQAVIHRLSRLLKPGGMLLFRDHGRYDNA 318

  Fly   209 QLRFKPGNKIAENLYVRQDGTRSYFFSEEEVSKLFQENGFEVITNAYVHRRTLNLKEGVDVPRIF 273
            |||||.|..::||.|||.||||:|||::.|:.::|.|.|.....|...||..:|.|:.:.:.|::
  Rat   319 QLRFKKGRCLSENFYVRGDGTRAYFFTKGEIHRMFCEAGLHEKQNLVDHRLQVNRKKQIQMHRVW 383

  Fly   274 LQGKFRR 280
            :||||::
  Rat   384 VQGKFQK 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34195NP_001097360.1 Methyltransf_12 88..>175 CDD:369778 35/86 (41%)
Mettl8XP_008760176.1 SmtA 197..392 CDD:223574 87/200 (44%)
Methyltransf_12 203..307 CDD:285454 46/109 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D378076at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.