DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34195 and metl

DIOPT Version :9

Sequence 1:NP_001097360.1 Gene:CG34195 / 37018 FlyBaseID:FBgn0085224 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_647636.3 Gene:metl / 38197 FlyBaseID:FBgn0035247 Length:325 Species:Drosophila melanogaster


Alignment Length:291 Identity:112/291 - (38%)
Similarity:162/291 - (55%) Gaps:28/291 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 ITTQAKEL---SAVERQKLDEQNK---RGLVPEYKANKLE--------IDAQRNWDIFYKRNETR 59
            :.|.|:|:   :|.:..:.||:.:   :..|.:...:|:|        .||.:.||.||..::.|
  Fly    42 VLTDAREVFEFNAWDHVQWDEEQELAAKAAVAKNSTSKMEAEQKERFQTDAPKFWDSFYGIHDNR 106

  Fly    60 FFKDRHWTTREFQELLD---QEEFHEKRTLFEVGCGVGNLVFPLLEEQTSEEGCFSNSRFFFYAC 121
            |||||||...||.||..   .....:.|::||:||||||.:.|||:..       |..:...:.|
  Fly   107 FFKDRHWLFTEFPELAPLAADSAVLQPRSIFELGCGVGNTILPLLQYS-------SEPQLKVFGC 164

  Fly   122 DFSPRAVEFVRSNPLYDPSQISAFQCDITTQQVHDHIP--PSSVDICTLIFVLSAIHPQKFKDVV 184
            |||.||:|.:||...:|..:...|..|.|..  |..:|  .:|.||..:|||||||.|:|.:.|:
  Fly   165 DFSARAIEILRSQRQFDEKRCEVFVMDATLD--HWQVPFEENSQDIIVMIFVLSAIEPKKMQRVL 227

  Fly   185 QNLGKLLKPGGLLLFRDYGLYDMAQLRFKPGNKIAENLYVRQDGTRSYFFSEEEVSKLFQENGFE 249
            .|..:.|:|||||||||||.||:||||||.|..:.:|.|||.|||..|||:|||:..:..:.|.:
  Fly   228 DNCYRYLRPGGLLLFRDYGRYDLAQLRFKSGKCMEDNFYVRGDGTMVYFFTEEELRGMMTQAGLQ 292

  Fly   250 VITNAYVHRRTLNLKEGVDVPRIFLQGKFRR 280
            ........|..:|...|:.:.|:::|.|||:
  Fly   293 EEQLIVDRRLQVNRCRGLKMYRVWIQTKFRK 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34195NP_001097360.1 Methyltransf_12 88..>175 CDD:369778 34/88 (39%)
metlNP_647636.3 SmtA 95..324 CDD:223574 101/238 (42%)
Methyltransf_12 138..240 CDD:285454 44/110 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443415
Domainoid 1 1.000 44 1.000 Domainoid score I732
eggNOG 1 0.900 - - E1_KOG2361
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 148 1.000 Inparanoid score I1729
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D378076at33208
OrthoFinder 1 1.000 - - FOG0000942
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22809
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.900

Return to query results.
Submit another query.