DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34195 and Mettl2

DIOPT Version :9

Sequence 1:NP_001097360.1 Gene:CG34195 / 37018 FlyBaseID:FBgn0085224 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_001102309.1 Gene:Mettl2 / 363687 RGDID:1310240 Length:385 Species:Rattus norvegicus


Alignment Length:335 Identity:118/335 - (35%)
Similarity:168/335 - (50%) Gaps:75/335 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 AKELSAVERQKLDEQNKRGLVPEYKANKLEIDAQRNWDIFYKRNETRFFKDRHWTTREFQELLD- 76
            ::|.:|...:|:.|.:.:.:.||.:|: .|::|.:.||.|||.:|..|||||||...||.||.. 
  Rat    43 SEEQAAAAERKVQENSSQLVCPEKQAD-YEVNAHKYWDDFYKVHENGFFKDRHWLFTEFPELAPS 106

  Fly    77 -------------------------------------------------QEEFHEKRT------- 85
                                                             :|...:|.|       
  Rat   107 HDHLVNLHLEKQKNEVSKPRSSEDGPGLAAEQHKRPCTSHGCETRVPPVEEPVTQKLTHLEICAD 171

  Fly    86 ----------LFEVGCGVGNLVFPLLEEQTSEEGCFSNSRFFFYACDFSPRAVEFVRSNPLYDPS 140
                      :.||||||||.|||:|  ||:     :|...|.|.||||..|:|.|::|..||||
  Rat   172 DFPGSSATYRILEVGCGVGNTVFPIL--QTN-----NNPDLFVYCCDFSATAIELVKTNSEYDPS 229

  Fly   141 QISAFQCDITTQQVHDHIPPSSVDICTLIFVLSAIHPQKFKDVVQNLGKLLKPGGLLLFRDYGLY 205
            :..||..|:..:.....:|..|:|:..||||||||.|.|.:..:..|.:||||||::|.||||.|
  Rat   230 RCFAFVHDLCDEDQSYPMPKDSLDVIVLIFVLSAIVPDKMQKAISKLSRLLKPGGVMLLRDYGRY 294

  Fly   206 DMAQLRFKPGNKIAENLYVRQDGTRSYFFSEEEVSKLFQENGFEVITNAYVHRRTLNLKEGVDVP 270
            ||||||||.|..::.|.|||.||||.|||:::|:..||...|.|.:.|....|..:|..:.:.:.
  Rat   295 DMAQLRFKKGQCLSGNFYVRGDGTRVYFFTQDELDTLFTAAGLEKVQNVVDRRLQVNRGKQLTMY 359

  Fly   271 RIFLQGKFRR 280
            |:::|.|:.:
  Rat   360 RVWIQCKYSK 369

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34195NP_001097360.1 Methyltransf_12 88..>175 CDD:369778 41/86 (48%)
Mettl2NP_001102309.1 SmtA 181..>302 CDD:223574 64/127 (50%)
Methyltransf_12 183..285 CDD:285454 51/108 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 163 1.000 Domainoid score I3887
eggNOG 1 0.900 - - E1_KOG2361
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D378076at33208
OrthoFinder 1 1.000 - - FOG0000942
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.820

Return to query results.
Submit another query.