DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34195 and Mettl6

DIOPT Version :9

Sequence 1:NP_001097360.1 Gene:CG34195 / 37018 FlyBaseID:FBgn0085224 Length:283 Species:Drosophila melanogaster
Sequence 2:XP_006252644.1 Gene:Mettl6 / 290564 RGDID:1359565 Length:317 Species:Rattus norvegicus


Alignment Length:300 Identity:154/300 - (51%)
Similarity:194/300 - (64%) Gaps:42/300 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 QAKELSAVERQKLDEQNKRGLVPEYKANKLEIDAQRNWDIFYKRNETRFFKDRHWTTREFQELLD 76
            |.:.||..|.:||  :..:.||..:|..|||.:||:|||:|||||.|.||||||||||||:||..
  Rat    10 QTRILSTGEEEKL--KRDQALVSAFKQQKLEKEAQKNWDLFYKRNSTNFFKDRHWTTREFEELRS 72

  Fly    77 QEEFH-EKRTLFEVGCGVGNLVFPLLEEQTSEEGCFSNSRFFFYACDFSPRAVEFVRSNPLYDPS 140
            ..|:. :|.||.|.||||||.:||||||         :|..|.||||||||||::|:.:|||:..
  Rat    73 CREYEGQKLTLLEAGCGVGNCLFPLLEE---------DSNIFAYACDFSPRAVDYVKQHPLYNAE 128

  Fly   141 QISAFQCDITTQQVHDHIPPSSVDICTLIFVLSAIHPQKFKDVVQNLGK---------------- 189
            :...||||:|...:.|||||.|||..||||||||:||:|...|:.|:.|                
  Rat   129 RCKVFQCDLTRDDLLDHIPPESVDAVTLIFVLSAVHPEKMHLVLLNVYKALLPPGVKLRGPGSTA 193

  Fly   190 --------------LLKPGGLLLFRDYGLYDMAQLRFKPGNKIAENLYVRQDGTRSYFFSEEEVS 240
                          :||||..:|||||||.|.|.||||.|:|:.||.||||||||||||::|.::
  Rat   194 GSTTVKNCCGGATEVLKPGRSVLFRDYGLNDHAMLRFKAGSKLGENFYVRQDGTRSYFFTDEFLA 258

  Fly   241 KLFQENGFEVITNAYVHRRTLNLKEGVDVPRIFLQGKFRR 280
            |||.:.|:|.:.|.||.|.|:|.|||:.|||:|||.|||:
  Rat   259 KLFVDAGYEEVVNEYVFRETVNKKEGLCVPRVFLQSKFRK 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34195NP_001097360.1 Methyltransf_12 88..>175 CDD:369778 49/86 (57%)
Mettl6XP_006252644.1 SmtA 35..298 CDD:223574 144/271 (53%)
Methyltransf_12 84..184 CDD:285454 56/108 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166354246
Domainoid 1 1.000 72 1.000 Domainoid score I9176
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H12069
Inparanoid 1 1.050 310 1.000 Inparanoid score I2527
OMA 1 1.010 - - QHG51971
OrthoDB 1 1.010 - - D378076at33208
OrthoFinder 1 1.000 - - FOG0000942
OrthoInspector 1 1.000 - - oto96533
orthoMCL 1 0.900 - - OOG6_104549
Panther 1 1.100 - - LDO PTHR22809
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X3769
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1413.910

Return to query results.
Submit another query.