DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34195 and Mettl8

DIOPT Version :9

Sequence 1:NP_001097360.1 Gene:CG34195 / 37018 FlyBaseID:FBgn0085224 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_663499.2 Gene:Mettl8 / 228019 MGIID:2385142 Length:388 Species:Mus musculus


Alignment Length:356 Identity:122/356 - (34%)
Similarity:175/356 - (49%) Gaps:85/356 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 PLEPDVITTQA--------------KELSAVERQKLDEQNKRGLVPEYKANKLEIDAQRNWDIFY 53
            ||...::|..|              ||.....|:|::|.:...:.||.:. |.|.||.:.|||||
Mouse    30 PLGSRILTDPAKVFEHNMWDHMQWSKEEEDAARKKVEENSATRVAPEEQV-KFESDANKYWDIFY 93

  Fly    54 KRNETRFFKDRHWTTREFQELL------------------------------------------- 75
            :.::.:|||:|:|..|||.|:|                                           
Mouse    94 QTHKNKFFKNRNWLLREFPEILPVNQNTKEKVGESSWDQVGSSISRTQGTETHCQESFVSPEPGS 158

  Fly    76 --------DQEEFHE--KRT-----------LFEVGCGVGNLVFPLLEEQTSEEGCFSNSRFFFY 119
                    |.||:.:  .:|           :.|||||.||.|||:|....:..|.      |.|
Mouse   159 RGRSAPDPDLEEYSKGPGKTEPFPGSNATFRILEVGCGAGNSVFPILNTLQNIPGS------FLY 217

  Fly   120 ACDFSPRAVEFVRSNPLYDPSQISAFQCDITTQQVHDHIPPSSVDICTLIFVLSAIHPQKFKDVV 184
            .|||:..|||.|:|:..|..:|.|||..|:....:....|...:|:..|:||||:|||.:.:.|.
Mouse   218 CCDFASEAVELVKSHESYSEAQCSAFIHDVCDDGLAYPFPDGILDVVLLVFVLSSIHPDRMQAVA 282

  Fly   185 QNLGKLLKPGGLLLFRDYGLYDMAQLRFKPGNKIAENLYVRQDGTRSYFFSEEEVSKLFQENGFE 249
            ..|.:||||||:|||||:|.||.||||||.|..::||.|||.||||:|||::.|:.::|.|.|..
Mouse   283 HRLSRLLKPGGMLLFRDHGRYDNAQLRFKKGRCLSENFYVRGDGTRAYFFTKGEIRRMFCEAGLH 347

  Fly   250 VITNAYVHRRTLNLKEGVDVPRIFLQGKFRR 280
            ...|...||..:|.|:.|.:.|:::||||::
Mouse   348 EKQNLVDHRLQVNRKKQVQMHRVWIQGKFQK 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34195NP_001097360.1 Methyltransf_12 88..>175 CDD:369778 35/86 (41%)
Mettl8NP_663499.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 139..180 4/40 (10%)
Methyltransf_25 190..293 CDD:379312 44/108 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2361
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.