DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34195 and METTL6

DIOPT Version :9

Sequence 1:NP_001097360.1 Gene:CG34195 / 37018 FlyBaseID:FBgn0085224 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_689609.2 Gene:METTL6 / 131965 HGNCID:28343 Length:284 Species:Homo sapiens


Alignment Length:274 Identity:153/274 - (55%)
Similarity:197/274 - (71%) Gaps:14/274 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 QAKELSAVERQKLDEQNKRGLVPEYKANKLEIDAQRNWDIFYKRNETRFFKDRHWTTREFQELLD 76
            ||:.|::.|.:||  :..:.||.::|..|||.:||:|||:|||||.|.||||||||||||:||..
Human    10 QARILTSEEEEKL--KRDQTLVSDFKQQKLEQEAQKNWDLFYKRNSTNFFKDRHWTTREFEELRS 72

  Fly    77 QEEFH-EKRTLFEVGCGVGNLVFPLLEEQTSEEGCFSNSRFFFYACDFSPRAVEFVRSNPLYDPS 140
            ..||. :|.|:.|.||||||.:||||||         :...|.|||||||||:|:|:.|||||..
Human    73 CREFEDQKLTMLEAGCGVGNCLFPLLEE---------DPNIFAYACDFSPRAIEYVKQNPLYDTE 128

  Fly   141 QISAFQCDITTQQVHDHIPPSSVDICTLIFVLSAIHPQKFKDVVQNLGKLLKPGGLLLFRDYGLY 205
            :...||||:|...:.||:||.|||:..|||||||:||.|...|:||:.|:||||..:||||||||
Human   129 RCKVFQCDLTKDDLLDHVPPESVDVVMLIFVLSAVHPDKMHLVLQNIYKVLKPGKSVLFRDYGLY 193

  Fly   206 DMAQLRFKPGNKIAENLYVRQDGTRSYFFSEEEVSKLFQENGFEVITNAYVHRRTLNLKEGVDVP 270
            |.|.||||..:|:.||.||||||||||||:::.:::||.:.|:|.:.|.||.|.|:|.|||:.||
Human   194 DHAMLRFKASSKLGENFYVRQDGTRSYFFTDDFLAQLFMDTGYEEVVNEYVFRETVNKKEGLCVP 258

  Fly   271 RIFLQGKFRR--KN 282
            |:|||.||.:  ||
Human   259 RVFLQSKFLKPPKN 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34195NP_001097360.1 Methyltransf_12 88..>175 CDD:369778 48/86 (56%)
METTL6NP_689609.2 Methyltransf_12 84..182 CDD:369778 58/106 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165160176
Domainoid 1 1.000 74 1.000 Domainoid score I9220
eggNOG 1 0.900 - - E1_KOG2361
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H12069
Inparanoid 1 1.050 313 1.000 Inparanoid score I2579
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG51971
OrthoDB 1 1.010 - - D378076at33208
OrthoFinder 1 1.000 - - FOG0000942
OrthoInspector 1 1.000 - - oto89407
orthoMCL 1 0.900 - - OOG6_104549
Panther 1 1.100 - - LDO PTHR22809
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1971
SonicParanoid 1 1.000 - - X3769
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.