DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34195 and mettl8

DIOPT Version :9

Sequence 1:NP_001097360.1 Gene:CG34195 / 37018 FlyBaseID:FBgn0085224 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_001007337.1 Gene:mettl8 / 100148927 ZFINID:ZDB-GENE-041114-19 Length:342 Species:Danio rerio


Alignment Length:288 Identity:111/288 - (38%)
Similarity:161/288 - (55%) Gaps:36/288 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 RQKLDEQNKRGLVPEYKANKLEIDAQRNWDIFYKRNETRFFKDRHWTTREFQELL---------- 75
            |||. |:|....:|..:.:|.:.:|.:.||.||:.::.:||::|:|...||.|||          
Zfish    60 RQKA-EENSEEKIPVEEQSKYDREAHKYWDQFYEMHQNKFFRNRNWLFTEFPELLPPDTGGMLMA 123

  Fly    76 DQEE------------------FHEKRTLFEVGCGVGNLVFPLLEEQTSEEGCFSNSRFFFYACD 122
            :||:                  .|....:.|||||.||.|||::       .....|:.|.|.||
Zfish   124 EQEQGLQSVNREKHNYKDTYPGHHAAFRILEVGCGAGNSVFPII-------NTIRGSKAFLYCCD 181

  Fly   123 FSPRAVEFVRSNPLYDPSQISAFQCDITTQQVHDHIPPSSVDICTLIFVLSAIHPQKFKDVVQNL 187
            ||.||:|.::.:|.|||:...||..||.........||.|:||..::||||||||.:.:.||:.|
Zfish   182 FSSRAIELIQKHPDYDPAVCHAFVRDICDATSPFPFPPESLDIILVVFVLSAIHPARAQAVVRGL 246

  Fly   188 GKLLKPGGLLLFRDYGLYDMAQLRFKPGNKIAENLYVRQDGTRSYFFSEEEVSKLFQENGFEVIT 252
            ..|||.||::||||||.||::|||||.|..::||.|.|||||..|||:::||..||...|.|.:.
Zfish   247 AGLLKQGGMVLFRDYGRYDLSQLRFKKGQCLSENFYSRQDGTCVYFFTKDEVHDLFSAAGLEELQ 311

  Fly   253 NAYVHRRTLNLKEGVDVPRIFLQGKFRR 280
            |....|..:|..:.:.:.|:::|.|:|:
Zfish   312 NLEDRRLQVNRGKKILMHRVWMQSKYRK 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34195NP_001097360.1 Methyltransf_12 88..>175 CDD:369778 37/86 (43%)
mettl8NP_001007337.1 Methyltransf_12 153..256 CDD:285454 49/109 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2361
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D378076at33208
OrthoFinder 1 1.000 - - FOG0000942
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.