DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34195 and mettl6

DIOPT Version :9

Sequence 1:NP_001097360.1 Gene:CG34195 / 37018 FlyBaseID:FBgn0085224 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_001096483.1 Gene:mettl6 / 100125105 XenbaseID:XB-GENE-5809155 Length:295 Species:Xenopus tropicalis


Alignment Length:283 Identity:157/283 - (55%)
Similarity:196/283 - (69%) Gaps:23/283 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 EPLEPDVITTQAKE-----LSAVERQKLDEQNKRGLVPEYKANKLEIDAQRNWDIFYKRNETRFF 61
            |||      .|.||     |::.|.:||  ||....|.|:|..|||.:||:|||:|||||.|.||
 Frog    23 EPL------FQRKEHELRILTSEEAEKL--QNDTDFVSEFKQLKLEREAQKNWDLFYKRNSTNFF 79

  Fly    62 KDRHWTTREFQELLDQEEFHEKRT-LFEVGCGVGNLVFPLLEEQTSEEGCFSNSRFFFYACDFSP 125
            ||||||||||:||....||.::|. :.|.||||||.:||||||..|         .|.|||||||
 Frog    80 KDRHWTTREFEELKACREFEQQRLFILEAGCGVGNCLFPLLEEDPS---------LFVYACDFSP 135

  Fly   126 RAVEFVRSNPLYDPSQISAFQCDITTQQVHDHIPPSSVDICTLIFVLSAIHPQKFKDVVQNLGKL 190
            |||:||:.||.|......|||||:|...:.|:||.:|||:.||||||||:||.:...|:||:.|:
 Frog   136 RAVDFVKKNPSYCAETCKAFQCDLTKDDLTDNIPANSVDVSTLIFVLSAVHPDRMHLVLQNICKV 200

  Fly   191 LKPGGLLLFRDYGLYDMAQLRFKPGNKIAENLYVRQDGTRSYFFSEEEVSKLFQENGFEVITNAY 255
            |||||.:|||||||||.|.||||.|:|:.||.||||||||||||:::.:..||::.|||.::|.|
 Frog   201 LKPGGCVLFRDYGLYDHAMLRFKSGSKLGENFYVRQDGTRSYFFTKDYLRCLFEKAGFEEVSNEY 265

  Fly   256 VHRRTLNLKEGVDVPRIFLQGKF 278
            |.|.|:|.||.:.|||:|:|.||
 Frog   266 VLRETVNKKESLCVPRVFIQSKF 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34195NP_001097360.1 Methyltransf_12 88..>175 CDD:369778 49/86 (57%)
mettl6NP_001096483.1 Methyltransf_25 105..205 CDD:379312 59/108 (55%)
AdoMet_MTases <169..261 CDD:388410 58/91 (64%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 72 1.000 Domainoid score I9198
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H12069
Inparanoid 1 1.050 304 1.000 Inparanoid score I2616
OMA 1 1.010 - - QHG51971
OrthoDB 1 1.010 - - D378076at33208
OrthoFinder 1 1.000 - - FOG0000942
OrthoInspector 1 1.000 - - oto103238
Panther 1 1.100 - - LDO PTHR22809
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X3769
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1111.080

Return to query results.
Submit another query.