DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34195 and mettl2a

DIOPT Version :9

Sequence 1:NP_001097360.1 Gene:CG34195 / 37018 FlyBaseID:FBgn0085224 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_001017902.1 Gene:mettl2a / 100006618 ZFINID:ZDB-GENE-050417-462 Length:353 Species:Danio rerio


Alignment Length:300 Identity:120/300 - (40%)
Similarity:167/300 - (55%) Gaps:42/300 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 ELSAVERQ---KLDEQNKRGLVPEYKANKLEIDAQRNWDIFYKRNETRFFKDRHWTTREFQELLD 76
            |.||.:.:   |..::|.:.| |..|..:.:..|...|:.||..:|.||||||||...||.||..
Zfish    57 EWSAEQEEAALKKVQENSQPL-PAEKQEEFDNRANEYWNDFYTIHENRFFKDRHWLFTEFPELAP 120

  Fly    77 QEEF----HEKRTL---------------------------FEVGCGVGNLVFPLLEEQTSEEGC 110
            |::.    .||.:|                           .||||||||.|||:|:..      
Zfish   121 QQKHLRGAEEKESLEHMLNGEDISLNPTHDEFPGASASYRILEVGCGVGNTVFPILKTN------ 179

  Fly   111 FSNSRFFFYACDFSPRAVEFVRSNPLYDPSQISAFQCDITTQQVHDHIPPSSVDICTLIFVLSAI 175
             ::...|.|.||||..||:.|:|||.||||:..||..|::.:.....:|..|:|:..|||||||:
Zfish   180 -NDPGLFVYCCDFSSTAVDLVKSNPEYDPSRCHAFVHDMSDESGEYPMPDHSLDVIVLIFVLSAL 243

  Fly   176 HPQKFKDVVQNLGKLLKPGGLLLFRDYGLYDMAQLRFKPGNKIAENLYVRQDGTRSYFFSEEEVS 240
            ||:|.:..:..||:||||||:||.||||.|||||||||.|..::||.|||.|||..|||:::|:.
Zfish   244 HPEKMQKSINRLGRLLKPGGVLLLRDYGRYDMAQLRFKKGRCLSENFYVRGDGTLVYFFTQDELH 308

  Fly   241 KLFQENGFEVITNAYVHRRTLNLKEGVDVPRIFLQGKFRR 280
            .||...|.|.:.|....|..:|..:.:.:.|:::|.|:|:
Zfish   309 DLFSSAGLEKLQNLADRRLQVNRGKQLTMYRVWVQCKYRK 348

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34195NP_001097360.1 Methyltransf_12 88..>175 CDD:369778 40/86 (47%)
mettl2aNP_001017902.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..37
Methyltransf_25 161..263 CDD:379312 50/108 (46%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 173 1.000 Domainoid score I3661
eggNOG 1 0.900 - - E1_KOG2361
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D378076at33208
OrthoFinder 1 1.000 - - FOG0000942
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.