| Sequence 1: | NP_001163182.1 | Gene: | CG4984 / 37017 | FlyBaseID: | FBgn0034267 | Length: | 447 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001371730.1 | Gene: | CACNG7 / 59284 | HGNCID: | 13626 | Length: | 305 | Species: | Homo sapiens |
| Alignment Length: | 52 | Identity: | 18/52 - (34%) |
|---|---|---|---|
| Similarity: | 31/52 - (59%) | Gaps: | 10/52 - (19%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 33 CSLLMVVSLLIWIVAISTDHWIIISGGKGIFIPESR--RFFMSSHSGLWRHC 82 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG4984 | NP_001163182.1 | PMP22_Claudin | 38..>93 | CDD:473919 | 15/47 (32%) |
| PMP22_Claudin | <315..420 | CDD:473919 | |||
| CACNG7 | NP_001371730.1 | PMP22_Claudin | 18..>143 | CDD:473919 | 18/52 (35%) |
| PHA03378 | <162..291 | CDD:223065 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||