DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4984 and CACNG7

DIOPT Version :10

Sequence 1:NP_001163182.1 Gene:CG4984 / 37017 FlyBaseID:FBgn0034267 Length:447 Species:Drosophila melanogaster
Sequence 2:NP_001371730.1 Gene:CACNG7 / 59284 HGNCID:13626 Length:305 Species:Homo sapiens


Alignment Length:52 Identity:18/52 - (34%)
Similarity:31/52 - (59%) Gaps:10/52 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 CSLLMVVSLLIWIVAISTDHWIIISGGKGIFIPESR--RFFMSSHSGLWRHC 82
            |.||:|.      :|:|||:|:.:.  :|..:|:::  ...|:.|:||||.|
Human    19 CGLLLVG------IAVSTDYWLYME--EGTVLPQNQTTEVKMALHAGLWRVC 62

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4984NP_001163182.1 PMP22_Claudin 38..>93 CDD:473919 15/47 (32%)
PMP22_Claudin <315..420 CDD:473919
CACNG7NP_001371730.1 PMP22_Claudin 18..>143 CDD:473919 18/52 (35%)
PHA03378 <162..291 CDD:223065
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.