powered by:
Protein Alignment CG4984 and CACNG4
DIOPT Version :9
Sequence 1: | NP_001163182.1 |
Gene: | CG4984 / 37017 |
FlyBaseID: | FBgn0034267 |
Length: | 447 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_055220.1 |
Gene: | CACNG4 / 27092 |
HGNCID: | 1408 |
Length: | 327 |
Species: | Homo sapiens |
Alignment Length: | 45 |
Identity: | 16/45 - (35%) |
Similarity: | 22/45 - (48%) |
Gaps: | 8/45 - (17%) |
- Green bases have known domain annotations that are detailed below.
Fly 46 VAISTDHWII----ISGGKGIFI----PESRRFFMSSHSGLWRHC 82
:||.||:|:. |..|..:.: |..|.....:||||||.|
Human 26 IAIGTDYWLYSSAHICNGTNLTMDDGPPPRRARGDLTHSGLWRVC 70
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
1 |
1.050 |
72 |
1.000 |
Inparanoid score |
I5301 |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.050 |
|
Return to query results.
Submit another query.