DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4984 and C46C11.3

DIOPT Version :9

Sequence 1:NP_001163182.1 Gene:CG4984 / 37017 FlyBaseID:FBgn0034267 Length:447 Species:Drosophila melanogaster
Sequence 2:NP_508792.1 Gene:C46C11.3 / 180735 WormBaseID:WBGene00016706 Length:241 Species:Caenorhabditis elegans


Alignment Length:244 Identity:64/244 - (26%)
Similarity:98/244 - (40%) Gaps:60/244 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   220 VIPEVAQLAIFRNW-------TDY-PLVVRL--LGTYIRDISIPAYVLNDERVILILVP--PLPP 272
            ||..||.||. .:|       ||| |:.|.|  .|.| |.|:      ..::|.:..:|  |.||
 Worm    42 VIMLVAALAT-TSWATIDFVNTDYHPIHVDLGVWGEY-RKIN------TFKKVTVEWIPHFPAPP 98

  Fly   273 KKGQPAYYSYIPNQRCKYIDMFPNSNALRNEPGFDDELLVAWYSLSDYIRTQASFACITLFVMSL 337
            :                        |.||          :|...|..|.|:||...|....::..
 Worm    99 E------------------------NILR----------LADTHLQHYYRSQAFMGCFGAVILLC 129

  Fly   338 GAVFSFYTFMNPRYMFKRLAGGIHLVAASTALVVLQVLFSSID----YTKEHLFYAYPEGAQLTY 398
            ..|.:.|||.:.|||:||....::||.|......:::|.|||:    ...::..:.|..|.::  
 Worm   130 TNVLAVYTFYHHRYMYKRAVAALYLVVAMCIFGAIEILSSSINEWNTAVAQNGEFDYEAGKKM-- 192

  Fly   399 GYGVYLAWFTFVDNILCGVMFLWYSGKKKGAKAPNDEVAMADEPTIMGR 447
            ||...||......:::..:.|...|.|:||..|...|:.:.|....:||
 Worm   193 GYSTRLAQGAIATSLIACLAFALGSHKQKGEHAATAELEIEDREYHIGR 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4984NP_001163182.1 PMP22_Claudin 38..>93 CDD:304458
C46C11.3NP_508792.1 PMP22_Claudin 40..213 CDD:304458 54/214 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - oto17240
orthoMCL 1 0.900 - - OOG6_117773
Panther 1 1.100 - - LDO PTHR10671
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R16921
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.900

Return to query results.
Submit another query.