DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4984 and CACNG2

DIOPT Version :9

Sequence 1:NP_001163182.1 Gene:CG4984 / 37017 FlyBaseID:FBgn0034267 Length:447 Species:Drosophila melanogaster
Sequence 2:NP_006069.1 Gene:CACNG2 / 10369 HGNCID:1406 Length:323 Species:Homo sapiens


Alignment Length:129 Identity:29/129 - (22%)
Similarity:50/129 - (38%) Gaps:38/129 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 MFQRRVLLGCSLLMVV----SLLIWIVAISTDHWIIISG---GKGIFIPES--RRFFMSSHSGLW 79
            :|.|.|.:   ||..|    :..:..:|:.||:|:...|   .|.:...|:  :...:.:|||||
Human     3 LFDRGVQM---LLTTVGAFAAFSLMTIAVGTDYWLYSRGVCKTKSVSENETSKKNEEVMTHSGLW 64

  Fly    80 RHCRNTIVPNAMSNAQVVRNFSSMSYTSQTNINEAKRNLSQMDFIKEFAHEKLETSDNFTESAR 143
            |.|            .:..||..:              ..|:|...|.|..:.:|::.|..:.|
Human    65 RTC------------CLEGNFKGL--------------CKQIDHFPEDADYEADTAEYFLRAVR 102

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4984NP_001163182.1 PMP22_Claudin 38..>93 CDD:304458 15/63 (24%)
CACNG2NP_006069.1 PMP22_Claudin 6..197 CDD:395662 28/126 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 233..261
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I5301
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.