DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4975 and MEE50

DIOPT Version :9

Sequence 1:NP_001137693.2 Gene:CG4975 / 37016 FlyBaseID:FBgn0034266 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_567156.1 Gene:MEE50 / 826583 AraportID:AT4G00231 Length:475 Species:Arabidopsis thaliana


Alignment Length:490 Identity:99/490 - (20%)
Similarity:167/490 - (34%) Gaps:129/490 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 KELVHKLVRLSITENEEEISALLKN-LRLLL--TKGRENQETLAESAEFSSFLNAVAFSPVMRTE 70
            :|::..|:..|      ::|..|:: |:.||  :|....:..||..:...|.|..:...|...:.
plant     7 EEVLQPLLHAS------DLSYSLEDCLKFLLESSKTDSGRSDLASKSILPSILRLLQLLPYPSSR 65

  Fly    71 HRLIHNLSLQVLANSVVNNETTQALIWSQHGLKIAEQAYASPLGSSNNVL--LMIMYNIYISGHG 133
            |.|  ||||:||.|......:.|.......|..|......|.:.....|.  |.::.|:.:.|. 
plant    66 HYL--NLSLKVLRNLCAGEVSNQNSFVDHDGSAIVSDLLDSAIADFETVRFGLQVLANVVLFGE- 127

  Fly   134 LITDLVALKTCLQLWRALNEAQCTYNFEYLHFFLEHFIVQNGRACVACYQKLETEDRVAFLDY-- 196
                    |....:|              |.|:.|.|:      .:|..:|.||.|.:..:.|  
plant   128 --------KRQRDVW--------------LRFYPERFL------SIAKIRKRETFDPLCMILYTC 164

  Fly   197 -------------------VAHYLRENSPNGDVTLFLLQHFAKEFRMKSDCLLRETIKL----KH 238
                               :|..||.:|..|.|..:.|:.......::....|:...||    ::
plant   165 VDGSSEIASELCSCQGLTIIAETLRTSSSVGSVEDYWLKLLVSRICVEDGYFLKLFSKLYEDAEN 229

  Fly   239 ELHPREVHTLLRIIASASGSEKYANV-YPNDQ----------------------------SLFIN 274
            |:...|...|:|:::..: :|:...| .|.|.                            |..::
plant   230 EIFSSEQAFLVRMVSDIA-NERIGKVSIPKDTACSILGLFRQSVDVFDFVSGERSELPTGSTIVD 293

  Fly   275 VSS----LLRCIVSAGK-------EPDGGG--------------------LDKPMTKLEEVALTS 308
            |..    ::|...:.|:       ..|.|.                    ||.|.|..:.:..:.
plant   294 VMGYSLVIIRDACAGGRLEELKEDNKDSGDTVELLLSSGLIELLLDLLSKLDPPTTIKKALNQSP 358

  Fly   309 DIDAGYEKKVSYE-LKTLLVRCSANLLYDNKANKGYCLDTQLLPTLLECTTMDARNPLMREWSIL 372
            ...:...|...|. .:..:|....|..|..|..:....:...|..:|:....|..||.:|||.:.
plant   359 SSSSSSLKPCPYRGFRRDIVSVIGNCAYRRKEVQDEIRERDGLFLMLQQCVTDDENPFLREWGLW 423

  Fly   373 AIRNACINCPEAQQVIAGLTMQGSAPNDILTELNL 407
            .|||.....||.|:|:|.|.::||.....|.|:.|
plant   424 CIRNLLEGNPENQEVVAELEIKGSVDVPQLREIGL 458

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4975NP_001137693.2 Atx10homo_assoc 322..408 CDD:286802 26/86 (30%)
MEE50NP_567156.1 Atx10homo_assoc 373..472 CDD:286802 26/86 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 43 1.000 Domainoid score I4768
eggNOG 1 0.900 - - E1_KOG2676
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005736
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_104233
Panther 1 1.100 - - LDO PTHR13255
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.860

Return to query results.
Submit another query.