DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4975 and atxn10

DIOPT Version :9

Sequence 1:NP_001137693.2 Gene:CG4975 / 37016 FlyBaseID:FBgn0034266 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_001015825.1 Gene:atxn10 / 548542 XenbaseID:XB-GENE-959678 Length:485 Species:Xenopus tropicalis


Alignment Length:442 Identity:100/442 - (22%)
Similarity:163/442 - (36%) Gaps:75/442 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MEHVKSETKELVHKLVRLSITENEEEISA-LLKNLRLLLTKGRENQET------LAESAEFSSFL 58
            :..|..|.|  |..|...:.|:...::.| ..:.||....:...||::      :.||.......
 Frog    64 LSRVSCEIK--VATLPAGAFTDTHCQLPAECFRCLRNACVQCASNQDSVRNVGLIEESVRLIQIF 126

  Fly    59 NAVAFSPVMRTEHRLI-HNLSLQVLANSVVNNETTQALIWSQHGLKIAEQAYASP---------- 112
            .|    |.:..|..|: ....||.|.|:...|..:|..:|          |.|.|          
 Frog   127 GA----PHVLQEPALVAFRCGLQFLGNTAAGNRDSQNAVW----------ACAFPDLFLSCLVHD 177

  Fly   113 ----LGSSNNVLLMIMYNIYISGHGLITDLVALKTCLQLWRALN---EAQCTYNFEYLHFFLEHF 170
                :..|:.||...:....:|   .:.|...|...|.:..|.:   :|:..|.....||.|...
 Frog   178 DEKVVTYSSMVLFTCINREKVS---TLQDPSKLDVALSVVTAYSKYPDAEWMYLIVMDHFLLCPD 239

  Fly   171 IVQNGRACVACYQKLETEDRVAFLDYVAHYLRENSPNGDVTLFLLQHFAKEFRMKSDCL---LRE 232
            :|:      |.|....:.:||..|:.:...:.:..|........||..|   ...|||.   .:.
 Frog   240 LVK------AVYLSQSSPERVTLLELILGKISQKEPLSAEESEALQAIA---AFLSDCFQTQCKT 295

  Fly   233 TIKLK-----HELHPREVHTLLRIIASASGSEKYANVYPNDQSLFINVSSLLRCIVSAGKEPDGG 292
            .:||.     .|..|..|..||.|:...:...::.:.......|......:||....|||:.   
 Frog   296 ILKLTSPSACDEEEPIVVTRLLDILCEVTSKNEHLSCLQTCPGLLEAAVDILRLTHLAGKQS--- 357

  Fly   293 GLDKPMTKLEEVALTSDIDAGYEKKVSYELKTLLVRCSANLLYDNKAN--KGYCLDTQLLPTLLE 355
              ....|....:::..|:     ...:...|..|:|...||.|.||.|  |.|.||.  :..:|:
 Frog   358 --MNVFTAAHTMSMGQDL-----THAAVGFKAHLIRLIGNLCYQNKENQEKVYQLDG--IALILD 413

  Fly   356 CTTMDARNPLMREWSILAIRNACINCPEAQQVIAGLTMQGSAPNDILTELNL 407
            ..::|..||.:.:|::.||||...|..:.|::||.:..||.|.:.:|..:.|
 Frog   414 NCSIDDNNPFLNQWAVFAIRNLTENNDKNQELIASMERQGLADSSLLKSMGL 465

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4975NP_001137693.2 Atx10homo_assoc 322..408 CDD:286802 31/88 (35%)
atxn10NP_001015825.1 Atx10homo_assoc 380..477 CDD:370667 31/88 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 55 1.000 Domainoid score I10991
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 58 1.000 Inparanoid score I5232
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005736
OrthoInspector 1 1.000 - - oto103570
Panther 1 1.100 - - LDO PTHR13255
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.150

Return to query results.
Submit another query.