DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4975 and Atxn10

DIOPT Version :9

Sequence 1:NP_001137693.2 Gene:CG4975 / 37016 FlyBaseID:FBgn0034266 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_058539.2 Gene:Atxn10 / 54138 MGIID:1859293 Length:475 Species:Mus musculus


Alignment Length:442 Identity:106/442 - (23%)
Similarity:176/442 - (39%) Gaps:88/442 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MEHVKSETKELVHKLVR------LSITENEEEISAL-----LKNLRLLLTKGRENQETLAESAEF 54
            :||:.| :.:|:.:..|      :..:.|:..|..|     ..:|.||..:.|..|::|      
Mouse    71 VEHLAS-SLQLITECFRCLRNACIECSVNQNSIRNLDTIGVAVDLVLLFRELRVEQDSL------ 128

  Fly    55 SSFLNAVAFSPVMRTEHRLIHNLSLQVLANSVVNNETTQALIWSQHGLKIAEQAYASPLGSSNNV 119
                 ..||            ...||.|.|....||.:|:::|    :....:.:.|.|...:..
Mouse   129 -----LTAF------------RCGLQFLGNVASRNEESQSIVW----VHAFPELFMSCLNHPDKK 172

  Fly   120 LLMIMYNIYISGHGLITDLVA-----LKTCLQLWRALN--EAQCTYNFEYLHFFL--EHFIVQNG 175
            ::.....|      |.|.|.|     |:..|.:  |:|  ||...:......|.:  :||: ::.
Mouse   173 IVAYCSMI------LFTSLNAERMKDLEENLNI--AINVIEAHQKHPASEWPFLIISDHFL-KSP 228

  Fly   176 RACVACYQKLETEDRVAFLDYVAHYL--RENSPNGDVTLFLLQH---FAKEFRMKSDCLLRETIK 235
            ....|.|.||..::|:..||.|...|  .|.....|:::| ::|   .|..|  ...|  |..:|
Mouse   229 ELVEAMYGKLSNQERITLLDIVIAKLVGEEQLTKDDISIF-VRHAELIANSF--MDQC--RNVLK 288

  Fly   236 LKHELHPREVHTLLRI------IASASGSE--KYANVYPNDQSLFINVSSLLRCIVSAGKEPDGG 292
            |..|.|..:...|:.|      ....|.:|  .|..|:|   .|...|..:||.|...|||  ..
Mouse   289 LTSEPHTEDKEALVTIRLLDVLCEMTSNTELLGYLQVFP---GLMERVIDVLRVIHEVGKE--ST 348

  Fly   293 GLDKPMTKLEEVALTSDIDAGYEKKVSYELKTLLVRCSANLLYDNKANKGYCLDTQLLPTLLECT 357
            .:..|...|:.......:..|:        |:.|:|...||.|.||.|:....:...:|.:|:.:
Mouse   349 NIFSPSDSLKAEGDIEHMTEGF--------KSHLIRLIGNLCYKNKENQDKVNELDGIPLILDSS 405

  Fly   358 TMDARNPLMREWSILAIRNACINCPEAQQVIAGLTMQGSAPNDILTELNLDM 409
            .:|..||.|.:|.:.|:||...:..:.|.|||.:..||.|...:|.::..::
Mouse   406 NIDDNNPFMMQWVVYAVRNLTEDNSQNQDVIAKMEEQGLADASLLKKMGFEI 457

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4975NP_001137693.2 Atx10homo_assoc 322..408 CDD:286802 27/85 (32%)
Atxn10NP_058539.2 Atx10homo_assoc 370..467 CDD:286802 27/96 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 55 1.000 Domainoid score I11121
eggNOG 1 0.900 - - E1_KOG2676
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 73 1.000 Inparanoid score I5278
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005736
OrthoInspector 1 1.000 - - oto93332
orthoMCL 1 0.900 - - OOG6_104233
Panther 1 1.100 - - LDO PTHR13255
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R770
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
109.850

Return to query results.
Submit another query.