DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4975 and ATXN10

DIOPT Version :9

Sequence 1:NP_001137693.2 Gene:CG4975 / 37016 FlyBaseID:FBgn0034266 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_037368.1 Gene:ATXN10 / 25814 HGNCID:10549 Length:475 Species:Homo sapiens


Alignment Length:428 Identity:98/428 - (22%)
Similarity:165/428 - (38%) Gaps:97/428 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 VRLSITENE----EEISALLKNLRLLLTKGRENQETLAESAEFSSFLNAVAFSPVMRTEHRLIHN 76
            :..|:.:|.    :.|...: :|.||..:.|..||:|           ..||            .
Human    93 IECSVNQNSIRNLDTIGVAV-DLILLFRELRVEQESL-----------LTAF------------R 133

  Fly    77 LSLQVLANSVVNNETTQALIWSQHGLKIAEQAYASPLGSSNNVLLMIMYNIYISGHGLITDL--V 139
            ..||.|.|....||.:|:::|    :....:.:.|.|...:..:  :.|:..|    |.|.|  .
Human   134 CGLQFLGNIASRNEDSQSIVW----VHAFPELFLSCLNHPDKKI--VAYSSMI----LFTSLNHE 188

  Fly   140 ALKTCLQLWRALNEA-------QCTYNFEYLHFFLEHFIVQNGRACVACYQKLETEDRVAFLDYV 197
            .:|   :|...||.|       |.....|:....:....:::.....|.:.||..::||..||.:
Human   189 RMK---ELEENLNIAIDVIDAYQKHPESEWPFLIITDLFLKSPELVQAMFPKLNNQERVTLLDLM 250

  Fly   198 AHYLRENSP--NGDVTLFLLQH---FAKEFRMKSDCLLRETIKLKHELHPREVHT-----LLRII 252
            ...:..:.|  ..|:.:| |:|   .|..|  ...|  :..:||..|..|.:...     ||.::
Human   251 IAKITSDEPLTKDDIPVF-LRHAELIASTF--VDQC--KTVLKLASEEPPDDEEALATIRLLDVL 310

  Fly   253 ASASGSEK---YANVYPNDQSLFINVSSLLRCIVSAGKEPDGGGLDKPMTKLEEVALTSDIDA-- 312
            ...:.:.:   |..|:|   .|...|..|||.|..||||                  |::|.:  
Human   311 CEMTVNTELLGYLQVFP---GLLERVIDLLRVIHVAGKE------------------TTNIFSNC 354

  Fly   313 ------GYEKKVSYELKTLLVRCSANLLYDNKANKGYCLDTQLLPTLLECTTMDARNPLMREWSI 371
                  |....|:...|:.|:|...||.|.||.|:....:...:|.:|:...:...||.:.:|.|
Human   355 GCVRAEGDISNVANGFKSHLIRLIGNLCYKNKDNQDKVNELDGIPLILDNCNISDSNPFLTQWVI 419

  Fly   372 LAIRNACINCPEAQQVIAGLTMQGSAPNDILTELNLDM 409
            .||||...:..:.|.:||.:..||.|...:|.::..::
Human   420 YAIRNLTEDNSQNQDLIAKMEEQGLADASLLKKVGFEV 457

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4975NP_001137693.2 Atx10homo_assoc 322..408 CDD:286802 26/85 (31%)
ATXN10NP_037368.1 Atx10homo_assoc 370..467 CDD:286802 26/88 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 48 1.000 Domainoid score I11993
eggNOG 1 0.900 - - E1_KOG2676
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 59 1.000 Inparanoid score I5402
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005736
OrthoInspector 1 1.000 - - oto89760
orthoMCL 1 0.900 - - OOG6_104233
Panther 1 1.100 - - LDO PTHR13255
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R770
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
109.850

Return to query results.
Submit another query.