DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4975 and LOC1274449

DIOPT Version :10

Sequence 1:NP_001137693.2 Gene:CG4975 / 37016 FlyBaseID:FBgn0034266 Length:418 Species:Drosophila melanogaster
Sequence 2:XP_313574.6 Gene:LOC1274449 / 1274449 VectorBaseID:AGAMI1_009315 Length:446 Species:Anopheles gambiae


Alignment Length:164 Identity:35/164 - (21%)
Similarity:49/164 - (29%) Gaps:51/164 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   334 ERRRDEPGRAPTNTAGGARVLDARTPPHPPLDGGIINSVENFQIIPKPLPVVGAPDGAQASNVLQ 398
            ||..||.|.|              .|..|.|......:|.:|.::|                  |
Mosquito   224 ERLEDEMGEA--------------EPMEPTLWFAQEMAVYDFSLLP------------------Q 256

  Fly   399 EPQLMKTSTSVSTSGKRSSDRNLQLPILAAPTVLPGPSLEQSSKRS-NGNGRAASDGGGGTLSAS 462
            ||..:..|.|             :|.:.:..|   .||:....|.| .|.|..|....||.:...
Mosquito   257 EPVPLAISDS-------------ELSVCSLST---EPSMRSEEKISWYGEGEEAEGEEGGEMECF 305

  Fly   463 SGSTSTTTSTTTTTSAPVRK--ANRSASSAARKP 494
            ......|..:...|.:.|.|  ||.......::|
Mosquito   306 PCECDLTDVSEVETESEVCKIDANPCCIEILKQP 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4975NP_001137693.2 Atx10homo_assoc 322..409 CDD:462885 16/74 (22%)
LOC1274449XP_313574.6 None

Return to query results.
Submit another query.