DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Snx16 and SNX29

DIOPT Version :9

Sequence 1:NP_611252.1 Gene:Snx16 / 37015 FlyBaseID:FBgn0034265 Length:407 Species:Drosophila melanogaster
Sequence 2:XP_011521040.1 Gene:SNX29 / 92017 HGNCID:30542 Length:879 Species:Homo sapiens


Alignment Length:383 Identity:83/383 - (21%)
Similarity:145/383 - (37%) Gaps:107/383 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 GYGNNNNHLAAPARTSQA---TLFKKASTAITSPKKSLLKTGNSVCGL---------------D- 59
            |:|:..:.|...|...::   :..::|:.|:.:.|..|.:...|:..|               | 
Human   457 GHGSPLSSLLPSASVPESMTISELRQATVAMMNRKDELEEENRSLRNLLDGEMEHSAALRQEVDT 521

  Fly    60 -KRSQFREQKLLGRKCHSSPDLRQIGKYQNNSLLRS----KSEGDVSLI--LASNSGAPLTVANA 117
             ||....:::..|.|..:.....::.|.|....:.:    |.||..:.:  |.|..| .:|||..
Human   522 LKRKVAEQEERQGMKVQALARENEVLKVQLKKYVGAVQMLKREGQTAEVPNLWSVDG-EVTVAEQ 585

  Fly   118 KSEVCLQRISSHSYEQSPRTPINKSEMLG-----GARSHRDL-TQSSYGNQAGGHSVDLESRSRT 176
            |.....:.::| |||   |..|..:||.|     ..|.||.| .:.:..:|.....:||  |...
Human   586 KPGEIAEELAS-SYE---RKLIEVAEMHGELIEFNERLHRALVAKEALVSQMRQELIDL--RGPV 644

  Fly   177 PRRMSECSLGYSQSSSRHTGSNSMFASQMTLSSGSVVPPVDPNAVLRVPIIGYEVMEERARFTAY 241
            |..:|:.|...|             .|...:|:.:::....|:..||        .:....|..|
Human   645 PGDLSQTSEDQS-------------LSDFEISNRALINVWIPSVFLR--------GKAANAFHVY 688

  Fly   242 K--LRVENPETNDYWLVMRRYTDFVRLNSKLKQAFPNL-TLMLPRKKLFGD-------------- 289
            :  :|::    :|.|.:.||||:|..|:.||:..:|.: ....|.||..|:              
Human   689 QVYIRIK----DDEWNIYRRYTEFRSLHHKLQNKYPQVRAYNFPPKKAIGNKPPPSPAWMTAAAS 749

  Fly   290 ----------------------NFNAVFLDNRVQGLQIFVNSVMAKEELRKCKLVREF 325
                                  :.:|.|::.|.:.||.::.|||.|    ..::|.||
Human   750 LLASLLPALPPLNLQVTSEVTSSQDAKFVEERRKQLQNYLRSVMNK----VIQMVPEF 803

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Snx16NP_611252.1 PX_SNX16 219..329 CDD:132809 32/146 (22%)
SNX29XP_011521040.1 RUN 54..189 CDD:280855
Ax_dynein_light <487..552 CDD:287215 11/64 (17%)
PX_RUN 668..820 CDD:132810 33/152 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2101
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.