DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Snx16 and SNX21

DIOPT Version :9

Sequence 1:NP_611252.1 Gene:Snx16 / 37015 FlyBaseID:FBgn0034265 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_219489.1 Gene:SNX21 / 90203 HGNCID:16154 Length:373 Species:Homo sapiens


Alignment Length:290 Identity:65/290 - (22%)
Similarity:108/290 - (37%) Gaps:86/290 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 KLLGRKCH-----------SSPDLRQIGKYQNNSLLRSKSEGDVSLILASNSGAPLTVANAKSEV 121
            :||.|..|           :||:..|..  :::.|....:||     |:|.....|:..:|:.: 
Human    13 RLLHRLRHALAGDGPGEAAASPEAEQFP--ESSELEDDDAEG-----LSSRLSGTLSFTSAEDD- 69

  Fly   122 CLQRISSHSYEQSPRTPINKSEM-LGGARSHRDLTQS-----SYGNQAGGHSV-DLESRSR---T 176
                   ...|..........:: ||...|..|..:|     .:|:|.....: |...:||   .
Human    70 -------EDDEDEDDEEAGPDQLPLGDGTSGEDAERSPPPDGQWGSQLLARQLQDFWKKSRNTLA 127

  Fly   177 PRRMSECSLGYSQSSSRHTGSNSMFASQMTLSSGSVV--PPVDPNAVLRVPIIGYEVMEERARFT 239
            |:|:                   :|    .::|.:||  ||                    :::.
Human   128 PQRL-------------------LF----EVTSANVVKDPP--------------------SKYV 149

  Fly   240 AYKLRVENPETNDYW--LVMRRYTDFVRLNSKLKQAF--PNLTLMLPRKKLFGDNFNAVFLDNRV 300
            .|.|.|..|...|..  .:.|||:||.||:..|::.|  |...:..|||:| ..||.|..:..|.
Human   150 LYTLAVIGPGPPDCQPAQISRRYSDFERLHRNLQRQFRGPMAAISFPRKRL-RRNFTAETIARRS 213

  Fly   301 QGLQIFVNSVMAKEELRKCKLVREFFCLDE 330
            :..:.|:..:.|..|||....:::||.|.|
Human   214 RAFEQFLGHLQAVPELRHAPDLQDFFVLPE 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Snx16NP_611252.1 PX_SNX16 219..329 CDD:132809 30/113 (27%)
SNX21NP_219489.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..107 20/108 (19%)
PX_SNX21 131..242 CDD:132834 36/154 (23%)
TPR repeat 244..268 CDD:276809 65/290 (22%)
TPR_12 247..312 CDD:290160
TPR repeat 281..312 CDD:276809
TPR repeat 326..353 CDD:276809
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2101
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.