DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Snx16 and SNX25

DIOPT Version :10

Sequence 1:NP_611252.1 Gene:Snx16 / 37015 FlyBaseID:FBgn0034265 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_001364961.1 Gene:SNX25 / 83891 HGNCID:21883 Length:1037 Species:Homo sapiens


Alignment Length:155 Identity:41/155 - (26%)
Similarity:62/155 - (40%) Gaps:27/155 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   223 RVPIIGYEVMEERAR-----FTAYKLR-VENPETNDYWLVMRRYTDFVRLNSKLKQAFPNL-TLM 280
            :..|...||.||...     |....|: |...||.: |.|.||.::|..|:.||.:..|:| .:.
Human   708 KASITSGEVTEENGEQLPCYFVMVSLQEVGGVETKN-WTVPRRLSEFQNLHRKLSECVPSLKKVQ 771

  Fly   281 LPR-KKLFGDNFNAVFLDNRVQGLQIFVNSVMAKEELRKCKLVREFFCLDEPPSY---------- 334
            ||. .||...:.:..|::.....|..|:.::::.|.|  |:....:..|...|.|          
Human   772 LPSLSKLPFKSIDQKFMEKSKNQLNKFLQNLLSDERL--CQSEALYAFLSPSPDYLKVIDVQGKK 834

  Fly   335 -----SESMEEC-RAIFEAQEETIE 353
                 |..:|.. |..|..|||..|
Human   835 NSFSLSSFLERLPRDFFSHQEEETE 859

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Snx16NP_611252.1 PX_SNX16 219..329 CDD:132809 30/113 (27%)
SNX25NP_001364961.1 PXA 166..321 CDD:460484
235kDa-fam <331..>691 CDD:130673
RGS_SNX25 488..596 CDD:188675
PX_SNX25 699..821 CDD:132788 31/115 (27%)
Nexin_C 898..1004 CDD:462541
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.