DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Snx16 and snx20

DIOPT Version :9

Sequence 1:NP_611252.1 Gene:Snx16 / 37015 FlyBaseID:FBgn0034265 Length:407 Species:Drosophila melanogaster
Sequence 2:XP_005163245.1 Gene:snx20 / 794759 ZFINID:ZDB-GENE-100806-1 Length:309 Species:Danio rerio


Alignment Length:155 Identity:36/155 - (23%)
Similarity:67/155 - (43%) Gaps:15/155 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   256 VMRRYTDFVRLNSKLKQAFPN--LTLMLPRKKLFGDNFNAVFLDNRVQGLQIFVNSVMAKEELRK 318
            :.|||:||:.|:.:|...|..  ..::.|:||: ..||:...:..|...|:.::..:.:...:||
Zfish   106 IERRYSDFLHLHQELLSDFSEELEDVVFPKKKM-TRNFSEEIIAERRVALRDYLTQLYSLRFVRK 169

  Fly   319 CKLVREFFCLDEPPS---------YSESMEECRAIFEAQEETIEHLKLQIRNKNDLILSLQQKLR 374
            .:..:.||...|..|         :|.::|..:.:...||:...|....:......||..|:.|.
Zfish   170 SQAFQSFFTHQELKSAYDLLRGGRFSRALEGLQKVLVLQEKLSSHDATLVIPTLCAILVCQRDLE 234

  Fly   375 EEMNEKEQLREAM---KNMELNCSH 396
            :.....|..|:|:   :..||...|
Zfish   235 DFEAAFETGRKALPTVRRYELRKHH 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Snx16NP_611252.1 PX_SNX16 219..329 CDD:132809 19/74 (26%)
snx20XP_005163245.1 PX_domain 69..182 CDD:295365 19/76 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2101
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.