DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Snx16 and Snx16

DIOPT Version :9

Sequence 1:NP_611252.1 Gene:Snx16 / 37015 FlyBaseID:FBgn0034265 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_083344.3 Gene:Snx16 / 74718 MGIID:1921968 Length:344 Species:Mus musculus


Alignment Length:315 Identity:99/315 - (31%)
Similarity:146/315 - (46%) Gaps:64/315 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 YQNNSLLRSKSEGDVSLILASNSG-------APLTVANAKSEVCLQRISSHSYEQSPRTPINKSE 143
            :.||...||.|.|.||....|:.|       ..|...|.:.::       .|......:|:.:::
Mouse    19 FTNNRNQRSSSFGSVSTSSTSSKGQLEDSAVGSLKQTNVQDQM-------DSASSMCGSPLIRTK 76

  Fly   144 MLGGARSHRDLTQSSYGNQAGGHSVDLESRSRTPRRMSECSLGYSQSSSRHTGSNSMFASQMTLS 208
            ..|...|.....:.....:....:|:.|.|..||                               
Mouse    77 FTGTDSSIEYSARPREAEEQHPEAVNWEDRPSTP------------------------------- 110

  Fly   209 SGSVVPPVDPNAVLRVPIIGYEVMEERARFTAYKLRV-ENPETNDYWLVMRRYTDFVRLNSKLKQ 272
                            .|:|||||||||:||.||:.| ::||  :.|:|.||||||.|||.|||:
Mouse   111 ----------------TILGYEVMEERAKFTVYKILVKKSPE--ESWVVFRRYTDFSRLNDKLKE 157

  Fly   273 AFPNLTLMLPRKKLFGDNFNAVFLDNRVQGLQIFVNSVMAKEELRKCKLVREFFCLDEPPSYSES 337
            .||...|.||.|:.|.||:||.||::|..|||.|:.:::|.:::..|..||||.|||:||...:|
Mouse   158 MFPGFRLALPPKRWFKDNYNAEFLEDRQLGLQAFLQNLVAHKDIANCLAVREFLCLDDPPGPFDS 222

  Fly   338 MEECRAIFEAQEETIEHLKLQIRNKNDLILSLQQKLREEMNEKEQLREAMKNMEL 392
            :||.||..|..|||..||:.::..|...:.||::.|.|:....:.|...::.:.|
Mouse   223 LEESRAFCETLEETNYHLQRELLEKQKEVESLKKLLGEKQLHIDALETRIRTLSL 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Snx16NP_611252.1 PX_SNX16 219..329 CDD:132809 56/110 (51%)
Snx16NP_083344.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..72 13/59 (22%)
PX_SNX16 105..214 CDD:132809 37/109 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167836625
Domainoid 1 1.000 100 1.000 Domainoid score I7039
eggNOG 1 0.900 - - E1_KOG2101
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005432
OrthoInspector 1 1.000 - - oto94821
orthoMCL 1 0.900 - - OOG6_109634
Panther 1 1.100 - - LDO PTHR22999
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5093
SonicParanoid 1 1.000 - - X5795
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1110.730

Return to query results.
Submit another query.