DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Snx16 and Snx29

DIOPT Version :9

Sequence 1:NP_611252.1 Gene:Snx16 / 37015 FlyBaseID:FBgn0034265 Length:407 Species:Drosophila melanogaster
Sequence 2:XP_006522729.1 Gene:Snx29 / 74478 MGIID:1921728 Length:819 Species:Mus musculus


Alignment Length:379 Identity:94/379 - (24%)
Similarity:147/379 - (38%) Gaps:106/379 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 ETGTGYGNNNNHLAAP--ARTSQATLFKKASTAITSPKKSLLKTGN-------------SVCGLD 59
            |.|||   ..||:...  .|.|:    :.:|....||..|||.:.:             .|..::
Mouse   425 ENGTG---TENHIIPEPGLRYSR----EASSPGQGSPLSSLLPSASVPESMTVHELRQAIVAMMN 482

  Fly    60 KRSQFREQ-----KLLGRKCHSSPDLRQ----------------IGKYQ----NNSLLR------ 93
            ::.:..|:     .||..:...|..|||                ..|.|    .|.:|:      
Mouse   483 RKDELEEENGSLRNLLDGEMEHSAALRQEVDALRRKVTEQQERHATKVQALARENEVLKVQLKKY 547

  Fly    94 ------SKSEGDVSLILAS--NSGAPLTVANAKSEVCLQRISSHSYEQSPRTPINKSEMLG---- 146
                  .|.||..:..:.|  |..|.:||...|.....:.::| |||   |..|..:||.|    
Mouse   548 VGAVQMLKREGQTAEAVPSLWNVDAEVTVPEQKPGEVAEELAS-SYE---RKLIEVAEMHGELIE 608

  Fly   147 -GARSHRDL-TQSSYGNQAGGHSVDLESRSRTPRRMSECSLGYSQSSSRHTGSNSMFASQMTLSS 209
             ..|.||.| .:.:..:|.....:||  |...|..:|:.|...|             .|...:|:
Mouse   609 FNERLHRALVAKEALVSQMRQELIDL--RGPVPGDLSQTSEDQS-------------LSDFEISN 658

  Fly   210 GSVVPPVDPNAVLRVPIIGYEVMEERARFTAYK--LRVENPETNDYWLVMRRYTDFVRLNSKLKQ 272
            .:::....|:..||        .:....|..|:  :|::    :|.|.|.||||:|..|:.:|:.
Mouse   659 RALINVWIPSVFLR--------GKAANAFHVYQVYIRIK----DDEWNVYRRYTEFRALHHQLQS 711

  Fly   273 AFPNL-TLMLPRKKLFGDNFNAVFLDNRVQGLQIFVNSVMAKEELRKCKLVREF 325
            |||.: ....|.||..| |.:|.|::.|.:.||.::.|||.|    ..::|.||
Mouse   712 AFPQVRAYSFPPKKAIG-NKDAKFVEERRKQLQSYLRSVMNK----VIQMVPEF 760

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Snx16NP_611252.1 PX_SNX16 219..329 CDD:132809 35/110 (32%)
Snx29XP_006522729.1 RUN 44..177 CDD:367169
Smc <472..>634 CDD:224117 35/165 (21%)
PX_RUN 662..779 CDD:132810 36/116 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2101
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.