DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Snx16 and snx21

DIOPT Version :9

Sequence 1:NP_611252.1 Gene:Snx16 / 37015 FlyBaseID:FBgn0034265 Length:407 Species:Drosophila melanogaster
Sequence 2:XP_012807968.2 Gene:snx21 / 733824 XenbaseID:XB-GENE-6455928 Length:385 Species:Xenopus tropicalis


Alignment Length:285 Identity:60/285 - (21%)
Similarity:109/285 - (38%) Gaps:66/285 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    97 EGDVSLILASNSGAPLTVA-NAK--------SEVCLQRISSHSYEQS-----PRTPINKSEM--- 144
            ||..|::...|.|..:.|| |:|        :...|||:.|...::.     |..|...:|:   
 Frog     5 EGAFSIMGLCNIGVEVRVAGNSKRSHYASIMASKLLQRLRSTPLKEERGPGPPDEPPESAELVDD 69

  Fly   145 -------LGGARSHRDLTQSSYGNQAGGHSVDLESRSRTPRRMSECSLGYSQSSSRHTGSNSMFA 202
                   |.|..|   |::.|..:|        ||.......:.  |.|:.:|.|:...|:    
 Frog    70 TEGLSLRLSGTLS---LSEDSLASQ--------ESDGMGTSYLG--SDGHGESKSQDENSS---- 117

  Fly   203 SQMTLSSGSVVPPVDPNAVLRVPI-IGYE------VMEERARFTAYKLRVENPETNDY----WLV 256
              .||.:..:....:.:..:|:|| :.:|      |.:..|::..|.:.:  .:|..|    ..:
 Frog   118 --YTLLTKQLREMWERSQNVRIPIRLTFEVTDANIVQDAHAKYVLYTIYL--LQTGQYDPSPAYI 178

  Fly   257 MRRYTDFVRLNSKLKQAFPN--LTLMLPRKKLFGDNFNAVFLDNRVQGLQIFVNSVMAKEELRKC 319
            ..||:|...|..:|...||:  ..:..|.|:: ..||....:..|.:..:.|:..|.:...||..
 Frog   179 SCRYSDLYHLKRRLLALFPSEMRGVSFPCKRV-RKNFTPETIAKRSRAFEQFLCHVASLPALRAS 242

  Fly   320 KLVREFFCLDEPPSYSESMEECRAI 344
            .....||       |...:::.:|:
 Frog   243 SAFLNFF-------YLRDIQKAQAL 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Snx16NP_611252.1 PX_SNX16 219..329 CDD:132809 27/122 (22%)
snx21XP_012807968.2 PX_SNX21 141..252 CDD:132834 25/120 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.