DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Snx16 and Snx20

DIOPT Version :9

Sequence 1:NP_611252.1 Gene:Snx16 / 37015 FlyBaseID:FBgn0034265 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_082116.1 Gene:Snx20 / 71607 MGIID:1918857 Length:313 Species:Mus musculus


Alignment Length:176 Identity:48/176 - (27%)
Similarity:77/176 - (43%) Gaps:40/176 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   232 MEER--ARFTAYKLRVENPET--NDYWLVMRRYTDFVRLNSKLKQAF-PNL-TLMLPRKKLFGDN 290
            :|||  ::|..|::.|....:  :|..:|.|||:||.||...|.:.| |.| .:..|||:|.| |
Mouse    82 IEERKVSKFVMYQVVVIQTGSFDSDKAVVERRYSDFERLQKALLKRFGPELEDVAFPRKRLTG-N 145

  Fly   291 FNAVFLDNRVQGLQIFVNSVMAKEELRKCKLVREFFCLDEPPSYSESMEECRAIFEAQEETIEHL 355
            .:|..:..|.:.|:.::..:.|...:|:.   |||......|...|:....||...|:       
Mouse   146 LSAETICERRRELREYLRLLYAVRAVRRS---REFLDFLTRPELREAFGCLRAGQYAR------- 200

  Fly   356 KLQIRNKNDLILSLQQKLREEMNEKEQLREAMKNMELNCSHCSSAS 401
            .|::..:   .|.||:||                    .:||.||:
Mouse   201 ALELLGR---ALPLQEKL--------------------TAHCPSAA 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Snx16NP_611252.1 PX_SNX16 219..329 CDD:132809 33/102 (32%)
Snx20NP_082116.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..60
PX_domain 73..186 CDD:383026 34/107 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2101
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.