DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Snx16 and Snx29

DIOPT Version :9

Sequence 1:NP_611252.1 Gene:Snx16 / 37015 FlyBaseID:FBgn0034265 Length:407 Species:Drosophila melanogaster
Sequence 2:XP_038942785.1 Gene:Snx29 / 689142 RGDID:1596162 Length:838 Species:Rattus norvegicus


Alignment Length:356 Identity:93/356 - (26%)
Similarity:149/356 - (41%) Gaps:72/356 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LRKRETGT-GYGNNNNHLAAPARTSQATL---FKKASTAITSPKKSLLKTGNSVCGL-----DKR 61
            ||.||.|: |.|:..:.|...|...::..   .::|..|:.:.|..|.:...|:..|     :..
  Rat   460 LRYREAGSPGRGSPLSSLLPSASVPESMTVHELRQAIVAMMNRKDELEEENGSLRNLLDGEMEHS 524

  Fly    62 SQFREQ-KLLGRKCHSSPDLRQIGKYQ----NNSLLR------------SKSEGDVSLILAS--N 107
            :..|:: ..|.||.....: |...|.|    .|.:|:            .|.||..:.::.|  |
  Rat   525 AALRQEVDALRRKVTEQQE-RHATKVQALARENEVLKVQLKKYVGAVQMLKREGQTAEVVPSLWN 588

  Fly   108 SGAPLTVANAKSEVCLQRISSHSYEQSPRTPINKSEMLG-----GARSHRDL-TQSSYGNQAGGH 166
            ..|.:||...|.....:.::| |||   |..|..:||.|     ..|.||.| .:.:..:|....
  Rat   589 VDAEVTVPEQKPGEVAEELAS-SYE---RKLIEVAEMHGELIEFNERLHRALVAKEALVSQMRQE 649

  Fly   167 SVDLESRSRTPRRMSECSLGYSQSSSRHTGSNSMFASQMTLSSGSVVPPVDPNAVLRVPII-GYE 230
            .:||  |...|..:|:.|...|             .|...:|:.:::....|:..||.... .|.
  Rat   650 LIDL--RGPVPGDLSQTSEDQS-------------LSDFEISNRALINVWIPSVFLRGKAANAYH 699

  Fly   231 VMEERARFTAYKLRVENPETNDYWLVMRRYTDFVRLNSKLKQAFPNL-TLMLPRKKLFGDNFNAV 294
            |      :..| :|::    :|.|.|.||||:|..|:.:|:.|||.: ....|.||..| |.:|.
  Rat   700 V------YQVY-IRIK----DDEWNVYRRYTEFRGLHHQLQSAFPQVRAYSFPPKKAIG-NKDAK 752

  Fly   295 FLDNRVQGLQIFVNSVMAKEELRKCKLVREF 325
            |::.|.:.||.::.|||.|    ..::|.||
  Rat   753 FVEERRKQLQSYLRSVMNK----VIQMVPEF 779

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Snx16NP_611252.1 PX_SNX16 219..329 CDD:132809 36/109 (33%)
Snx29XP_038942785.1 RUN 64..197 CDD:397055
COG1340 489..654 CDD:224259 40/171 (23%)
PX_RUN 681..798 CDD:132810 37/115 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2101
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.