DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Snx16 and SNX16

DIOPT Version :9

Sequence 1:NP_611252.1 Gene:Snx16 / 37015 FlyBaseID:FBgn0034265 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_071416.2 Gene:SNX16 / 64089 HGNCID:14980 Length:344 Species:Homo sapiens


Alignment Length:334 Identity:103/334 - (30%)
Similarity:149/334 - (44%) Gaps:76/334 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 YQNNSLLRSKSEGDVSLILASNSG--APLTVANAK-----------SEVCLQRISSHSYEQSPRT 137
            :..|...||.|.|.||....|:.|  ....:.|.|           |.||             .:
Human    19 FTTNRNQRSSSFGSVSTSSNSSKGQLEDSNMGNFKQTSVPDQMDNTSSVC-------------SS 70

  Fly   138 PINKSEMLGGARSHRDLTQSSYGNQAGGHSVDLESRSRTPRRMSECSLGYSQSSSRHTGSNSMFA 202
            |:.:::..|.|.|....|:.....:....:|:.|.|..||                         
Human    71 PLIRTKFTGTASSIEYSTRPRDTEEQNPETVNWEDRPSTP------------------------- 110

  Fly   203 SQMTLSSGSVVPPVDPNAVLRVPIIGYEVMEERARFTAYKLRV-ENPETNDYWLVMRRYTDFVRL 266
                                  .|:|||||||||:||.||:.| :.||  :.|:|.||||||.||
Human   111 ----------------------TILGYEVMEERAKFTVYKILVKKTPE--ESWVVFRRYTDFSRL 151

  Fly   267 NSKLKQAFPNLTLMLPRKKLFGDNFNAVFLDNRVQGLQIFVNSVMAKEELRKCKLVREFFCLDEP 331
            |.|||:.||...|.||.|:.|.||:||.||::|..|||.|:.:::|.:::..|..||||.|||:|
Human   152 NDKLKEMFPGFRLALPPKRWFKDNYNADFLEDRQLGLQAFLQNLVAHKDIANCLAVREFLCLDDP 216

  Fly   332 PSYSESMEECRAIFEAQEETIEHLKLQIRNKNDLILSLQQKLREEMNEKEQLREAMKNMELNCSH 396
            |...:|:||.||..|..|||...|:.::..|...:.||::.|.|:....:.|...::.:.|....
Human   217 PGPFDSLEESRAFCETLEETNYRLQKELLEKQKEMESLKKLLSEKQLHIDTLENRIRTLSLEPEE 281

  Fly   397 CSSASDSLG 405
            ....|::.|
Human   282 SLDVSETEG 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Snx16NP_611252.1 PX_SNX16 219..329 CDD:132809 56/110 (51%)
SNX16NP_071416.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..66 11/46 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 81..107 5/25 (20%)
PX_SNX16 105..214 CDD:132809 59/157 (38%)
SMC_N <231..>336 CDD:330553 14/60 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165146525
Domainoid 1 1.000 99 1.000 Domainoid score I7133
eggNOG 1 0.900 - - E1_KOG2101
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005432
OrthoInspector 1 1.000 - - oto91240
orthoMCL 1 0.900 - - OOG6_109634
Panther 1 1.100 - - LDO PTHR22999
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X5795
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
109.700

Return to query results.
Submit another query.