DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Snx16 and SNX14

DIOPT Version :9

Sequence 1:NP_611252.1 Gene:Snx16 / 37015 FlyBaseID:FBgn0034265 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_001337461.1 Gene:SNX14 / 57231 HGNCID:14977 Length:967 Species:Homo sapiens


Alignment Length:451 Identity:99/451 - (21%)
Similarity:165/451 - (36%) Gaps:148/451 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 KKSLLKTGNSVCGLDKRSQFREQK-LLGRKCHSSPDLRQIGKYQ-----------NNSLLRSKSE 97
            |.|:||.        :..|.|||: ||.|..:.   |:|.|...           |:.:||.:..
Human   350 KPSVLKL--------ELKQIREQQDLLFRFMNF---LKQEGAVHVLQFCLTVEEFNDRILRPELS 403

  Fly    98 GDVSLILASN-------------------------------SGAPLTVANAKSEVCLQRISSH-- 129
            .|..|.|...                               .|..:.|...::..||.....|  
Human   404 NDEMLSLHEELQKIYKTYCLDESIDKIRFDPFIVEEIQRIAEGPYIDVVKLQTMRCLFEAYEHVL 468

  Fly   130 SYEQSPRTPI--NKSE----MLGGARSHRDLTQSSYGNQAGGHSVDLESRSRTPRRMSECSLGYS 188
            |..::..||:  :..|    :|.||.|.   |::|..|:.   |:.|:....|.:|..  |.|.|
Human   469 SLLENVFTPMFCHSDEYFRQLLRGAESP---TRNSKLNRG---SLSLDDFRNTQKRGE--SFGIS 525

  Fly   189 QSSSRHTGSNSMFASQMTLSSGSVVP-----------------------PVD----PNA------ 220
            :..|:..|   :|.|  |...|:::|                       ||:    ||.      
Human   526 RIGSKIKG---VFKS--TTMEGAMLPNYGVAEGEDDFIEEGIVVMEDDSPVEAVSTPNTPRNLAA 585

  Fly   221 -VLRVPIIGY------EVMEERARFTAYKLRVENPETN------DYWLVMRRYTDFVRLNSKLKQ 272
             .:.:|.:.:      |..|::.|...:.:.||..:..      ::|.|.|||.:|..|.|||.:
Human   586 WKISIPYVDFFEDPSSERKEKKERIPVFCIDVERNDRRAVGHEPEHWSVYRRYLEFYVLESKLTE 650

  Fly   273 ---AFPNLTLMLPRKKLFGDNFNAVFLDNRVQGLQIFVNSVMAKEELRKCKLVREFFCLDEPPSY 334
               |||:  ..||.|::.|.. |..||.::.:..|.::..::...||...:|:.:|.    .|:.
Human   651 FHGAFPD--AQLPSKRIIGPK-NYEFLKSKREEFQEYLQKLLQHPELSNSQLLADFL----SPNG 708

  Fly   335 SESMEECRAIFEAQEETIEHLKLQIRNKNDLILSLQQKLREEMNEKEQ-LREAMKNMELNC 394
            .|:            :.::.:...: |...:|.|:..||   |.||.| |...:.|...:|
Human   709 GET------------QFLDKILPDV-NLGKIIKSVPGKL---MKEKGQHLEPFIMNFINSC 753

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Snx16NP_611252.1 PX_SNX16 219..329 CDD:132809 32/131 (24%)
SNX14NP_001337461.1 PXA 151..320 CDD:308031
RGS_SNX14 361..487 CDD:188677 24/128 (19%)
PX_SNX14 585..707 CDD:132787 31/128 (24%)
Nexin_C 828..932 CDD:312222
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2101
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.