DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Snx16 and sgk3

DIOPT Version :10

Sequence 1:NP_611252.1 Gene:Snx16 / 37015 FlyBaseID:FBgn0034265 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_001103937.1 Gene:sgk3 / 564523 ZFINID:ZDB-GENE-070424-62 Length:486 Species:Danio rerio


Alignment Length:126 Identity:41/126 - (32%)
Similarity:69/126 - (54%) Gaps:5/126 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   215 PVDPNAVLRVPIIGYEVMEERARFTAYKLRVENPETNDYWLVMRRYTDFVRLNSKLKQAFPNLTL 279
            |..||  :.:|... |..:::.|:|.||:.|.  .....|.|.|||.:|.:|.:.||:.||.|.|
Zfish     5 PSCPN--VSIPCYN-EQRDKKKRYTVYKVMVS--VGRHEWFVFRRYAEFDKLYNTLKKQFPALNL 64

  Fly   280 MLPRKKLFGDNFNAVFLDNRVQGLQIFVNSVMAKEELRKCKLVREFFCLDEPPSYSESMEE 340
            .:|.|::|||||:..|:..|..||..|:..:::..:|.....|:.|..:|:..::|:..|:
Zfish    65 KIPAKRIFGDNFDPEFIKQRRAGLHEFIQRIVSHSQLCSHPDVKVFLQMDKAKNFSDGSED 125

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Snx16NP_611252.1 PX_SNX16 219..329 CDD:132809 36/109 (33%)
sgk3NP_001103937.1 PX_CISK 6..114 CDD:132780 37/112 (33%)
STKc_SGK3 155..480 CDD:270755
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.