DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Snx16 and rps6kc1

DIOPT Version :10

Sequence 1:NP_611252.1 Gene:Snx16 / 37015 FlyBaseID:FBgn0034265 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_001352480.2 Gene:rps6kc1 / 564322 ZFINID:ZDB-GENE-081031-83 Length:925 Species:Danio rerio


Alignment Length:116 Identity:33/116 - (28%)
Similarity:47/116 - (40%) Gaps:28/116 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   228 GYEVMEERARFTAYKLRVENPETNDYWLVMRRYTDFVRLNSKLKQAFPNL----TLMLP--RKKL 286
            ||.|.:..||.    :...|||......|.:||:||.:|:..|.|.:.||    .|..|  :.|:
Zfish    25 GYTVYKVTARI----ISRNNPEDIQEITVWKRYSDFKKLHQDLWQIYRNLCGQSELFPPFAKAKV 85

  Fly   287 FGDNFNAVFLDNRVQGLQIFVNSVMAKEELRKCKLVREFFCLDEPPSYSES 337
            ||.                |.:||:  |:.|:|......|..:.|..|..|
Zfish    86 FGR----------------FDDSVI--EKRRQCSEDLLQFSANIPALYGSS 118

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Snx16NP_611252.1 PX_SNX16 219..329 CDD:132809 30/106 (28%)
rps6kc1NP_001352480.2 None

Return to query results.
Submit another query.