DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Snx16 and PXK

DIOPT Version :9

Sequence 1:NP_611252.1 Gene:Snx16 / 37015 FlyBaseID:FBgn0034265 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_001336421.1 Gene:PXK / 54899 HGNCID:23326 Length:581 Species:Homo sapiens


Alignment Length:168 Identity:52/168 - (30%)
Similarity:84/168 - (50%) Gaps:29/168 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   224 VPI-IGYEVMEERARFTAYKLRVENP-ETNDYWLVMRRYTDFVRLNSKLKQAFPNLTLMLPRKKL 286
            ||: ...|..:.....|.|.:||:.. ...:.|.::|||:||..||:.|:.|  .|:|.||.|||
Human    18 VPLTAAIEASQSLQSHTEYIIRVQRGISVENSWQIVRRYSDFDLLNNSLQIA--GLSLPLPPKKL 80

  Fly   287 FGDNFNAVFLDNRVQGLQIFVNSVMAKEELRKCKLVREFFCLDEPPSYSE-----SMEECRAIF- 345
            .| |.:..|:..|.:|||.::|.:.....|..|:||::|.   :|.:||.     ::::....| 
Human    81 IG-NMDREFIAERQKGLQNYLNVITTNHILSNCELVKKFL---DPNNYSANYTEIALQQVSMFFR 141

  Fly   346 -EAQEETIEHLK------------LQIRN--KNDLILS 368
             |.:.|.:|.||            ::|:|  |..|:||
Human   142 SEPKWEVVEPLKDIGWRIRKKYFLMKIKNQPKERLVLS 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Snx16NP_611252.1 PX_SNX16 219..329 CDD:132809 37/106 (35%)
PXKNP_001336421.1 PX_MONaKA 13..132 CDD:132781 40/119 (34%)
SPS1 186..492 CDD:223589
PKc 198..345 CDD:270622
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2101
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.