DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Snx16 and snx13

DIOPT Version :9

Sequence 1:NP_611252.1 Gene:Snx16 / 37015 FlyBaseID:FBgn0034265 Length:407 Species:Drosophila melanogaster
Sequence 2:XP_021323912.1 Gene:snx13 / 503733 ZFINID:ZDB-GENE-050306-12 Length:966 Species:Danio rerio


Alignment Length:375 Identity:80/375 - (21%)
Similarity:149/375 - (39%) Gaps:92/375 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 GKYQNN----SLLRSKSEGDVSLILASNSGAPLTVANAKSEVCLQRISSHSYEQSPRTP------ 138
            ||.|::    .|||:.:.|.....|:..:...:.|    .|..:.|::....::.| ||      
Zfish   428 GKRQSSQTTKGLLRAAALGVFDQYLSEKASPRVQV----DEASVTRLAQKLNKEDP-TPEIFDEI 487

  Fly   139 --------INKSEMLGGARSH-------RDLTQSSYGNQAGGHSVDLESRSRTPRRMSECSLGYS 188
                    :.........|.|       .:|......:..|....|.||.:.:|           
Zfish   488 QRKVYDMMLKHEHYYPSFRQHPLYVRMLAELDMLKEPSYRGSDDGDGESFNGSP----------- 541

  Fly   189 QSSSRHTGSNSMFASQMTLSSGSVVPPVDPNAVLR---------VPIIGYEVMEER----ARFTA 240
                  |||.::  |...||||||...|..:|.:.         :|:.|  |..:.    |.:|.
Zfish   542 ------TGSINL--SLDDLSSGSVDESVQLHAFISDTADAFLNPLPVAG--VCNDHGKTYALYTI 596

  Fly   241 YKLRVENPETNDYWLVMRRYTDFVRLNSKLKQAFPNLT--LMLPRKKLFGDNFNAVFLDNRVQGL 303
            ..:|..:..:.|.|...|||:||...:.::.:.|.:|.  |.||.||.| :|.:..||:.|.:.|
Zfish   597 TVIRKNSDGSEDTWKTYRRYSDFHDFHMRITEQFESLAPILKLPGKKTF-NNMDREFLEKRKKDL 660

  Fly   304 QIFVNSVMAKEELRKCKLVREF-FCLDEPPSYSESMEECRAIFEAQEET-IEHLKLQIRNKNDLI 366
            ..::..::..|.::.|.::..: :...|..:||:...|    |..:.:| :..|:..:||.::.:
Zfish   661 NAYLQLLLNPEMVKACPILMPYVYDFLENKAYSKGKRE----FARKMDTFVNPLRSSMRNVSNAV 721

  Fly   367 LSLQQKLRE----------EMNEK--EQLREA-------MKNMELNCSHC 397
            .||...|.|          .|:||  :.::::       ::..:::..||
Zfish   722 KSLPDSLAEGVSKVSADMGRMSEKLGQDIKQSIFKVPPLIQKSDIDPEHC 771

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Snx16NP_611252.1 PX_SNX16 219..329 CDD:132809 29/125 (23%)
snx13XP_021323912.1 PXA 98..284 CDD:321992
RGS 378..513 CDD:321993 16/89 (18%)
PX_SNX13 559..690 CDD:132783 31/133 (23%)
Nexin_C 806..915 CDD:312222
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2101
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.