DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Snx16 and snx16

DIOPT Version :9

Sequence 1:NP_611252.1 Gene:Snx16 / 37015 FlyBaseID:FBgn0034265 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_991228.1 Gene:snx16 / 402964 ZFINID:ZDB-GENE-040426-1832 Length:294 Species:Danio rerio


Alignment Length:243 Identity:87/243 - (35%)
Similarity:125/243 - (51%) Gaps:26/243 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   175 RTPRRMSECSLGYSQSSSRHTGSNSMFASQMTLSSGSVVPPVD------PNAVLRVP-------- 225
            |.||.        .:|:|.:|.......::..||...  |.|:      |:.:...|        
Zfish    14 RPPRA--------DRSTSSYTPPGQSPVTRARLSGPE--PSVEYCSCPRPDGLPDTPDTPRPATP 68

  Fly   226 -IIGYEVMEERARFTAYKLRVENPETNDYWLVMRRYTDFVRLNSKLKQAFPNLTLMLPRKKLFGD 289
             ::|||||||||:||.||:.|.. ..::.|:|.||||||.|||.|||..||...|.||.|:.|.|
Zfish    69 TVLGYEVMEERAKFTVYKVLVRK-NVDESWVVFRRYTDFSRLNDKLKDMFPGFRLSLPPKRWFKD 132

  Fly   290 NFNAVFLDNRVQGLQIFVNSVMAKEELRKCKLVREFFCLDEPPSYSESMEECRAIFEAQEETIEH 354
            |:...||:.|..|||.|:.:::|.:::..|..||||.|||:||...:|:||.||..|..||....
Zfish   133 NYETEFLEERQLGLQTFLQNLVAHKDIASCVAVREFLCLDDPPGPFDSLEESRAFCETLEECNYR 197

  Fly   355 LKLQIRNKNDLILSLQQKLREEMNEKEQLREAMKNMELNCSHCSSASD 402
            |:.::..|...|.||::.|.|:..:.::|.|.:....|........||
Zfish   198 LQKELLEKQREINSLKETLEEKELQIQKLEERISGPLLTPDSTCCVSD 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Snx16NP_611252.1 PX_SNX16 219..329 CDD:132809 52/118 (44%)
snx16NP_991228.1 PX_SNX16 63..172 CDD:132809 51/109 (47%)
DUF4200 <181..230 CDD:290574 16/48 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170580153
Domainoid 1 1.000 96 1.000 Domainoid score I7288
eggNOG 1 0.900 - - E1_KOG2101
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005432
OrthoInspector 1 1.000 - - oto41677
orthoMCL 1 0.900 - - OOG6_109634
Panther 1 1.100 - - LDO PTHR22999
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5093
SonicParanoid 1 1.000 - - X5795
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1211.730

Return to query results.
Submit another query.