DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Snx16 and snx15

DIOPT Version :9

Sequence 1:NP_611252.1 Gene:Snx16 / 37015 FlyBaseID:FBgn0034265 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_001104707.1 Gene:snx15 / 393352 ZFINID:ZDB-GENE-040426-1377 Length:398 Species:Danio rerio


Alignment Length:221 Identity:49/221 - (22%)
Similarity:84/221 - (38%) Gaps:54/221 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   228 GYEVMEERARFTAYKLRVENPETNDYWLVMRRYTDFVRLNSKLKQAFPNLTLM------LPRKKL 286
            |:...:..|||.: |.:.||.:....|   :|||:..:|:.:|.....||...      .||.::
Zfish    25 GHTEYKVTARFVS-KTQPENVKEVVVW---KRYTELKKLHGELAYTHRNLFRRQEEFPPFPRAQV 85

  Fly   287 FGDNFNAVFLD--NRVQGLQIFVNSVMAKEELRKCKLVREFFCLDE--------------PPSYS 335
            ||....||..:  |..:.:.:|..::.|   |.....::|||...|              ||...
Zfish    86 FGRFDEAVIEERRNAAEAMLLFTTNIPA---LYNSPQLKEFFRDGEVRRPLETAVISTSLPPPLI 147

  Fly   336 ESMEECRAIFEAQEETIEHLKLQIR--NKNDLILSLQQ---------KLR-------------EE 376
             .:.|..|...|:|||.....:|.:  :.|..:..|.|         ..|             :|
Zfish   148 -PLPERSADLLAEEETGTEAPIQAQELDSNQRLTDLTQPEIAVEALSDTRSSPTQETQTDAEIQE 211

  Fly   377 MNEKEQLREAMKNMELNCSHCSSASD 402
            :.|||...::..:...:...|::|:|
Zfish   212 LTEKETEDDSTTHENNHTGQCTAATD 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Snx16NP_611252.1 PX_SNX16 219..329 CDD:132809 28/108 (26%)
snx15NP_001104707.1 PX_SNX15 10..127 CDD:132821 28/108 (26%)
MIT_SNX15 321..395 CDD:239140
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2101
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.