DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Snx16 and Snx13

DIOPT Version :9

Sequence 1:NP_611252.1 Gene:Snx16 / 37015 FlyBaseID:FBgn0034265 Length:407 Species:Drosophila melanogaster
Sequence 2:XP_006240084.1 Gene:Snx13 / 362731 RGDID:1309778 Length:1144 Species:Rattus norvegicus


Alignment Length:197 Identity:49/197 - (24%)
Similarity:87/197 - (44%) Gaps:31/197 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   209 SGSVVPPVDPNAVLRVPIIGYEVMEERARFTAYKLRV--ENPETNDYWLVMRRYTDFVRLNSKLK 271
            |.:|....||.||..|      ..:....:..|.:.|  .:..|.:.|...|||:||...:.::.
  Rat   742 SDTVYADYDPYAVAGV------CNDHGKTYALYAITVHRRSLNTEEMWKTYRRYSDFHDFHMRIT 800

  Fly   272 QAFPNLT--LMLPRKKLFGDNFNAVFLDNRVQGLQIFVNSVMAKEELRK----CKLVREFFCLDE 330
            :.|.||:  |.||.||.| :|.:..||:.|.:.|..::..::..|.|:.    ...|.:|.   |
  Rat   801 EQFENLSSILKLPGKKTF-NNMDRDFLEKRKKDLNAYLQLLLTPEMLKASPALAHCVYDFL---E 861

  Fly   331 PPSYSESMEECRAIFEAQEET-IEHLKLQIRNKNDLILSLQQKLREEMNE--------KEQLREA 386
            ..:||:.    :..|..:.:| :..|:..:||.::.:.||...|.|.:.:        .|:|.:.
  Rat   862 NKAYSKG----KGDFARKMDTFVNPLRNSMRNVSNAVKSLPDSLAEGVTKMSDNVGRMSERLGQD 922

  Fly   387 MK 388
            :|
  Rat   923 IK 924

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Snx16NP_611252.1 PX_SNX16 219..329 CDD:132809 30/117 (26%)
Snx13XP_006240084.1 PXA 273..460 CDD:295366
RGS_SNX13 553..687 CDD:188674
PX_SNX13 733..863 CDD:132783 35/130 (27%)
Nexin_C 979..1087 CDD:285792
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2101
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.