Sequence 1: | NP_611252.1 | Gene: | Snx16 / 37015 | FlyBaseID: | FBgn0034265 | Length: | 407 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_006240084.1 | Gene: | Snx13 / 362731 | RGDID: | 1309778 | Length: | 1144 | Species: | Rattus norvegicus |
Alignment Length: | 197 | Identity: | 49/197 - (24%) |
---|---|---|---|
Similarity: | 87/197 - (44%) | Gaps: | 31/197 - (15%) |
- Green bases have known domain annotations that are detailed below.
Fly 209 SGSVVPPVDPNAVLRVPIIGYEVMEERARFTAYKLRV--ENPETNDYWLVMRRYTDFVRLNSKLK 271
Fly 272 QAFPNLT--LMLPRKKLFGDNFNAVFLDNRVQGLQIFVNSVMAKEELRK----CKLVREFFCLDE 330
Fly 331 PPSYSESMEECRAIFEAQEET-IEHLKLQIRNKNDLILSLQQKLREEMNE--------KEQLREA 386
Fly 387 MK 388 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Snx16 | NP_611252.1 | PX_SNX16 | 219..329 | CDD:132809 | 30/117 (26%) |
Snx13 | XP_006240084.1 | PXA | 273..460 | CDD:295366 | |
RGS_SNX13 | 553..687 | CDD:188674 | |||
PX_SNX13 | 733..863 | CDD:132783 | 35/130 (27%) | ||
Nexin_C | 979..1087 | CDD:285792 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG2101 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |