DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Snx16 and Snx24

DIOPT Version :9

Sequence 1:NP_611252.1 Gene:Snx16 / 37015 FlyBaseID:FBgn0034265 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_001008365.1 Gene:Snx24 / 361328 RGDID:1306864 Length:169 Species:Rattus norvegicus


Alignment Length:136 Identity:37/136 - (27%)
Similarity:64/136 - (47%) Gaps:10/136 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   224 VPIIGYEVMEERARFTAYKLRVENPETNDYWLVMRRYTDFVRLNSKLKQAFPNLTLMLPRKKLFG 288
            :|...:|..:....:|.:|:.|.......:  |.:||::|..|:.|||:...  |..:|.|.:  
  Rat     5 IPSFRHEDSDLERGYTVFKIEVLMNGRKHF--VEKRYSEFHALHKKLKKCIK--TPEIPSKHV-- 63

  Fly   289 DNFNAVFLDNRVQGLQIFVNSV-MAKEELRKCKLVREFFCLDEPPSYSESMEECRAIFEAQEETI 352
            .|:....|:.|.|||:.::.:| :..|||.  ||..:|..:...||..:: |.|.:..|.:.|..
  Rat    64 RNWVPKVLEQRRQGLETYLQAVILENEELP--KLFLDFLNVRHLPSLPKA-ESCGSFDETESEES 125

  Fly   353 EHLKLQ 358
            ..|..|
  Rat   126 SKLSHQ 131

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Snx16NP_611252.1 PX_SNX16 219..329 CDD:132809 29/105 (28%)
Snx24NP_001008365.1 PX_SNX22 1..111 CDD:132790 31/113 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2101
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.