DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Snx16 and CG8726

DIOPT Version :9

Sequence 1:NP_611252.1 Gene:Snx16 / 37015 FlyBaseID:FBgn0034265 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_610341.2 Gene:CG8726 / 35758 FlyBaseID:FBgn0033244 Length:646 Species:Drosophila melanogaster


Alignment Length:148 Identity:48/148 - (32%)
Similarity:73/148 - (49%) Gaps:19/148 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   215 PVDPNAVLRVPIIGYEVMEERARFTAYKLRVENPETN-DYWLVMRRYTDFVRLNSKLKQAFPNLT 278
            |:|....|...|   ..::|.|..|.|.|||....:| :||.|:|||.||.||:..|:.:  .:.
  Fly    13 PIDDTQALSCEI---TAVQEVAGHTEYLLRVWRGASNKNYWTVLRRYNDFDRLDKSLRVS--GIE 72

  Fly   279 LMLPRKKLFGDNFNAVFLDNRVQGLQIFVNSVMAKEELRKCKLVREFFCLDEPPSYSESMEECRA 343
            |.||||::|| |....|:..|.|.||.::|:|:....|......:.|.   :|.|||:|.     
  Fly    73 LPLPRKRIFG-NMRPEFIAERKQALQEYINAVLMNPILASSLPAKRFV---DPESYSQSF----- 128

  Fly   344 IFEAQEETIEHLKLQIRN 361
                .:..:::..|.:||
  Fly   129 ----HDHAVQNAMLCLRN 142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Snx16NP_611252.1 PX_SNX16 219..329 CDD:132809 38/110 (35%)
CG8726NP_610341.2 PX_MONaKA 13..132 CDD:132781 45/136 (33%)
PKc 237..432 CDD:270622
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448209
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2101
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22999
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.