DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Snx16 and CG5439

DIOPT Version :9

Sequence 1:NP_611252.1 Gene:Snx16 / 37015 FlyBaseID:FBgn0034265 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_609607.1 Gene:CG5439 / 34710 FlyBaseID:FBgn0032476 Length:520 Species:Drosophila melanogaster


Alignment Length:340 Identity:74/340 - (21%)
Similarity:129/340 - (37%) Gaps:77/340 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 NNNHLAAPARTSQATLFKKASTAI-TSPKKSLLKTGNSVCGLDKRSQFREQKLLGRKCHSSPD-- 79
            :...|.||.|::.:...|:..... |||.        .|.|..||.....::.:  :|.||.:  
  Fly   206 DTTELNAPRRSTPSVAVKEEPIIFTTSPV--------PVVGRQKRPGIAVERPI--ECVSSTEDL 260

  Fly    80 ---LRQIGKYQNNSLLRSKS--------EGDVSLILASNSGAPLTVANAKSEVC---LQRISSH- 129
               |:.|...:...:|..:|        :.:|:|       .|......:.|..   |..|.:| 
  Fly   261 LGALKPIESVEVQQILSKESIEQELAQPQEEVNL-------GPFDPIEPELEFLKTPLPDIGAHV 318

  Fly   130 ----SYEQSPRTPINKSEMLGG----ARSHRDLTQSSYGNQAGGHSVDLESRSRTPRRMSECSLG 186
                .||....|....|:....    |.|.:......:.||.......||:      |::|.|| 
  Fly   319 GESELYEDRSDTSSQWSKSSSSANCLANSQQQAALEEHVNQLNERCALLET------RVAELSL- 376

  Fly   187 YSQSSSRHTGSNSMFASQMTL---SSGSVVPPVDP------NAVLRVPIIGYEVMEERARFTAYK 242
                      .|.:...::|.   .:|     :||      |.::.:|.:.....:.......|:
  Fly   377 ----------QNRLLIRRLTKQFEETG-----IDPSSSLCSNFLITIPHVKLAKTQRSGSHYTYE 426

  Fly   243 LRVENPETNDYWLVMRRYTDFVRLNSKLKQAFPNLTLM-LPRKKLFGDNFNAVFLDNRVQGLQIF 306
            :.:...:..::|...|||::|.:|:..|.:..|.::.: .|.||.|| |.|.||::.|.|.|||:
  Fly   427 VHITMRQRLEHWTFFRRYSEFYKLHKSLLKTHPVVSAVEFPPKKHFG-NMNLVFVEERRQQLQIY 490

  Fly   307 -VNSVMAKEELRKCK 320
             :|.|....::..||
  Fly   491 LLNLVETLPQVEACK 505

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Snx16NP_611252.1 PX_SNX16 219..329 CDD:132809 29/104 (28%)
CG5439NP_609607.1 RUN 64..206 CDD:280855 74/340 (22%)
PX_RUN 404..520 CDD:132810 28/103 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2101
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.