DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Snx16 and Snx21

DIOPT Version :10

Sequence 1:NP_611252.1 Gene:Snx16 / 37015 FlyBaseID:FBgn0034265 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_608709.1 Gene:Snx21 / 33466 FlyBaseID:FBgn0031457 Length:326 Species:Drosophila melanogaster


Alignment Length:146 Identity:40/146 - (27%)
Similarity:59/146 - (40%) Gaps:12/146 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   208 SSGSVVPPVDPNAVLRVPIIGYEVME------ERARFTAYKLRVEN---PETNDYWLVMRRYTDF 263
            :|....|..|.:.|||..|:...:|.      :..||..|:|.|:.   .|......:.||||||
  Fly    57 TSAEYKPTTDGSTVLRFDILLAHIMPPDGEDVKIKRFVVYELTVKQDGATEDTQPAKIERRYTDF 121

  Fly   264 VRLNSKLKQAFP--NLTLMLPRKKLFGDNFNAVFLDNRVQGLQIFVNSVMAKEELRKCKLVREFF 326
            ..|...||:..|  ......|.|.|.| ||.:..:..|....:.|:..|.::..||..:....|.
  Fly   122 RELYLGLKRQHPAEMANKYFPAKVLMG-NFKSELIGERSAAFEAFLTYVASQAMLRDSEYFLRFL 185

  Fly   327 CLDEPPSYSESMEECR 342
            ..||.....:.::|.|
  Fly   186 QHDELTRACQFLDERR 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Snx16NP_611252.1 PX_SNX16 219..329 CDD:132809 33/120 (28%)
Snx21NP_608709.1 PX_SNX20_21_like 71..188 CDD:132812 32/117 (27%)

Return to query results.
Submit another query.