DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Snx16 and snz

DIOPT Version :9

Sequence 1:NP_611252.1 Gene:Snx16 / 37015 FlyBaseID:FBgn0034265 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_001284993.1 Gene:snz / 31704 FlyBaseID:FBgn0029976 Length:1117 Species:Drosophila melanogaster


Alignment Length:392 Identity:79/392 - (20%)
Similarity:130/392 - (33%) Gaps:120/392 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 QFREQKLLGRKCHSSPDLRQIGKYQNNSLLRSKSEGDVSLILAS---------NSG--------A 110
            |:|:.|       .:.|..:|.   :.:||...:.|||...||.         |.|        |
  Fly   528 QYRQLK-------EALDSNEIA---DPTLLMCHTIGDVQEPLADEQPGAADGLNGGAGGAIDVAA 582

  Fly   111 PLTVANAKSEVCLQRISSHSYEQSPRTPINKSEMLGGARSHRDLTQSSYGNQAGGHSVDLESR-- 173
            ..:.|..|.|...:||.            .|::.|...:                :||..||:  
  Fly   583 HTSYARRKLEQIQERID------------KKNQALDALK----------------YSVKPESKVL 619

  Fly   174 ---------SRTPRRMSECSLGYSQSSSRHTGSNSMFASQMTLSSGSVVPPVDPNAVLRVPIIGY 229
                     .::.:|.:|..|..:.:.:.|.|.     .:.|:.|   |...|....|:..|:.:
  Fly   620 TILEKEMEWLKSEKRQTEAHLRRTDAWTEHLGK-----WKATIQS---VEVSDEKESLQFMILVH 676

  Fly   230 --EVMEERARFTAYK--------LRVENPETNDYWLVMRRYTDFVRLNSKLKQAFPNL-TLMLPR 283
              |.:....:.|:.|        ||......:..|:|||.......|..||:....|| .:.|| 
  Fly   677 VDEDINAPVQPTSSKNGDSGHANLRKRPSGISSGWVVMRSLNQVHELQRKLRHVSSNLKAIDLP- 740

  Fly   284 KKLFGDNFNAVFLDNRVQG-------LQIFVNSVMAKEELRKCKLVREFFCLDEP------PSYS 335
                 .||...||.....|       :|.|:|.::..:.|...:.:..|......      ||..
  Fly   741 -----TNFKFFFLKTDRHGQEKAKSQIQKFLNFILEDDHLNGSEAIYTFLSPSSDHLKQSLPSPK 800

  Fly   336 ESMEECRAIF--------EAQEETIEHLKLQIRNKNDLILSLQ-------QKLREEMNEKEQLRE 385
            :|......:|        ||.:.|.....|| |:..|:...|.       :.|..:::.|:.:.|
  Fly   801 KSKFSLSTLFRSDAGKAHEASKATDPFWGLQ-RDDEDISTYLDGESGGEAKMLAADLDSKDSIAE 864

  Fly   386 AM 387
            .|
  Fly   865 PM 866

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Snx16NP_611252.1 PX_SNX16 219..329 CDD:132809 28/127 (22%)
snzNP_001284993.1 PXA 142..299 CDD:280373
RGS_SNX25 422..531 CDD:188675 1/2 (50%)
PX_SNX25 645..788 CDD:132788 34/156 (22%)
Nexin_C 882..987 CDD:285792
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2101
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.