DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Snx16 and Snx20

DIOPT Version :9

Sequence 1:NP_611252.1 Gene:Snx16 / 37015 FlyBaseID:FBgn0034265 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_001020170.1 Gene:Snx20 / 307742 RGDID:1307787 Length:313 Species:Rattus norvegicus


Alignment Length:139 Identity:38/139 - (27%)
Similarity:65/139 - (46%) Gaps:18/139 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   232 MEER--ARFTAYKLRVENPET--NDYWLVMRRYTDFVRLNSKLKQAF-PNL-TLMLPRKKLFGDN 290
            :|||  ::|..|::.|....:  :|..:|.|||:||.||...|.:.| |.| .:..|||:|.| |
  Rat    82 IEERKVSKFVMYQVVVIQTGSFDSDKAVVERRYSDFERLQRALLKRFGPELEDVTFPRKRLTG-N 145

  Fly   291 FNAVFLDNRVQGLQIFVNSVMAKEELRKCK----------LVREFFCLDEPPSYSESMEECRAIF 345
            .:|..:..|...|:.::..:.|...:|:.:          |...|.|| ....|:.:::....:.
  Rat   146 LSAETICERRLELREYLRLLYAVRAVRRSREFADFLTRPELCEAFGCL-RAGQYARALDLLGRVV 209

  Fly   346 EAQEETIEH 354
            ..||:...|
  Rat   210 PLQEKLTAH 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Snx16NP_611252.1 PX_SNX16 219..329 CDD:132809 33/112 (29%)
Snx20NP_001020170.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..61
PX_domain 73..186 CDD:295365 30/104 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2101
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.