DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Snx16 and Snx20

DIOPT Version :10

Sequence 1:NP_611252.1 Gene:Snx16 / 37015 FlyBaseID:FBgn0034265 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_001020170.1 Gene:Snx20 / 307742 RGDID:1307787 Length:313 Species:Rattus norvegicus


Alignment Length:139 Identity:38/139 - (27%)
Similarity:65/139 - (46%) Gaps:18/139 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   232 MEER--ARFTAYKLRVENPET--NDYWLVMRRYTDFVRLNSKLKQAF-PNL-TLMLPRKKLFGDN 290
            :|||  ::|..|::.|....:  :|..:|.|||:||.||...|.:.| |.| .:..|||:|.| |
  Rat    82 IEERKVSKFVMYQVVVIQTGSFDSDKAVVERRYSDFERLQRALLKRFGPELEDVTFPRKRLTG-N 145

  Fly   291 FNAVFLDNRVQGLQIFVNSVMAKEELRKCK----------LVREFFCLDEPPSYSESMEECRAIF 345
            .:|..:..|...|:.::..:.|...:|:.:          |...|.|| ....|:.:::....:.
  Rat   146 LSAETICERRLELREYLRLLYAVRAVRRSREFADFLTRPELCEAFGCL-RAGQYARALDLLGRVV 209

  Fly   346 EAQEETIEH 354
            ..||:...|
  Rat   210 PLQEKLTAH 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Snx16NP_611252.1 PX_SNX16 219..329 CDD:132809 33/112 (29%)
Snx20NP_001020170.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..61
PX_domain 73..186 CDD:470617 30/104 (29%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.