DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Snx16 and Snx22

DIOPT Version :9

Sequence 1:NP_611252.1 Gene:Snx16 / 37015 FlyBaseID:FBgn0034265 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_001100302.2 Gene:Snx22 / 300796 RGDID:1305042 Length:194 Species:Rattus norvegicus


Alignment Length:122 Identity:29/122 - (23%)
Similarity:54/122 - (44%) Gaps:26/122 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   213 VPPVDPNA--VLRVPIIGYEVMEERARFTAYKLRVENPETNDYWLVMRRYTDFVRLNSKLKQAF- 274
            :|.|.|.|  ..:.|..|:.|.:....::..:           ..|.|||::|..|:.::|:.: 
  Rat     6 IPSVGPEAEGPRQSPEKGHMVFQVEVLYSGRR-----------HTVPRRYSEFHALHKRIKKRYK 59

  Fly   275 -PNLTLMLPRKKLFGDNFNAVFLDNRVQGLQIFVNSVM-----AKEELRKCKLVREF 325
             |:    .|.|:|  .|:....|:.|.|||:.::..|:     ..:||.:...:|.|
  Rat    60 VPD----FPSKRL--PNWRTRGLEQRRQGLETYIQGVLYLNQDVPKELLEFLRLRHF 110

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Snx16NP_611252.1 PX_SNX16 219..329 CDD:132809 26/116 (22%)
Snx22NP_001100302.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2101
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.