DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Snx16 and SNX15

DIOPT Version :10

Sequence 1:NP_611252.1 Gene:Snx16 / 37015 FlyBaseID:FBgn0034265 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_037438.2 Gene:SNX15 / 29907 HGNCID:14978 Length:342 Species:Homo sapiens


Alignment Length:210 Identity:42/210 - (20%)
Similarity:76/210 - (36%) Gaps:56/210 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   229 YEVMEERAR---FTAYKLRVE-----NPETNDYWLVMRRYTDFVRLNSKLKQAFPNLTLML---- 281
            |.|.:.|..   :|.||:..:     :||.....:|.:||:||.:|:..|.....||...|    
Human    13 YTVSDPRTHPKGYTEYKVTAQFISKKDPEDVKEVVVWKRYSDFRKLHGDLAYTHRNLFRRLEEFP 77

  Fly   282 --PRKKLFGDNFNAVFLDNRVQGLQIFVNSVMAKEELRKCKLVREFF------------------ 326
              ||.::|| .|.|..::.|.:|.:..:...:....|.....::|||                  
Human    78 AFPRAQVFG-RFEASVIEERRKGAEDLLRFTVHIPALNNSPQLKEFFRGGEVTRPLEVSRDLHIL 141

  Fly   327 ---CLDEPPSYSESMEECRAIFEAQEETIEHLKLQIRNKNDLILSLQQKLREEMNEKEQLREAMK 388
               .:..||.....:.:   :..|:...:|.|::.:                :.......:||: 
Human   142 PPPLIPTPPPDDPRLSQ---LLPAERRGLEELEVPV----------------DPPPSSPAQEAL- 186

  Fly   389 NMELNCSHCSSASDS 403
            ::..||.....||.|
Human   187 DLLFNCESTEEASGS 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Snx16NP_611252.1 PX_SNX16 219..329 CDD:132809 30/134 (22%)
SNX15NP_037438.2 PX_domain 9..126 CDD:470617 30/113 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 245..267
MIT_SNX15 267..341 CDD:239140
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.